logo
Affymetrix Probeset: MED4_ARR_0016_x_at
Probeset Position: 18283..19002(+)
Number of probes: 11

Microarray Data of MED4_ARR_0016_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 1239.33 1878.0 0.65992 -0.599637 0.0438
Phosphate Starvation P-depleted 4 h 782.3 608.55 1.28551 0.362346 0.2847
Phosphate Starvation P-depleted 12 h 1213.0 877.03 1.38308 0.467881 0.154
Phosphate Starvation P-depleted 24 h 1435.0 1593.0 0.900816 -0.150696 0.742
Phosphate Starvation P-depleted 48 h 1003.3 734.25 1.36643 0.45041 0.119
Nitrogen Availability N deprivation 0 h NA NA 0.585918 -0.77123 0.052326
Nitrogen Availability N deprivation 3 h NA NA 0.831624 -0.265996 0.919388
Nitrogen Availability N deprivation 6 h NA NA 0.684258 -0.547388 0.323272
Nitrogen Availability N deprivation 12 h NA NA 0.859075 -0.219143 0.661509
Nitrogen Availability N deprivation 24 h NA NA 0.292442 -1.77378 0.0
Nitrogen Availability N deprivation 48 h NA NA 0.444346 -1.17024 0.241071
Nitrogen Availability Urea log phase NA NA 1.064 0.089495 0.897248
Nitrogen Availability Cyanate log phase NA NA 1.5284 0.612021 0.061225
Light Sensing High light 45 min NA NA 1.5663 0.647361 0.0
Light Sensing White light 45 min NA NA 1.9303 0.948825 0.0
Light Sensing Blue light 45 min NA NA 1.5654 0.646531 0.0
Light Sensing Red light 45 min NA NA 1.0502 0.070664 0.0
Light Sensing Green light 45 min NA NA 0.7331 -0.447918 0.0
Light Sensing White light+DCMU 45 min NA NA 0.733114 -0.447891 0.0
Iron Availability -Fe 0 h NA NA None 0.146655 0.899851
Iron Availability -Fe 12 h NA NA None 0.606916 0.016054
Iron Availability -Fe 24 h NA NA None 0.187768 0.223503
Iron Availability -Fe 48 h NA NA None 0.237564 0.14803
Iron Availability -Fe 70 h rescue NA NA None -0.354759 0.009412

Protein Info: PMED4_00151 Heat shock protein GrpE (grpE)
COG

Location: 18283 - 19002 (+) on scaffold: NC_005072
Protein Length: 239 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_00151
Alternative Tag: PMM0016
MicrobesOnline ID: VIMSS565346
CyCOG: 2360(ID from pipeline) - 2360 (ID from previou versions)
CyCOG Size: 23
NCBI COG: COG576

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0016_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_00151 GO:0000774 PF01025 adenyl-nucleotide exchange factor activity 3.60134e-43
PMED4_00151 GO:0042803 PF01025 protein homodimerization activity 3.60134e-43
PMED4_00151 GO:0051087 PF01025 chaperone binding 3.60134e-43
PMED4_00151 GO:0006457 PF01025 protein folding 3.60134e-43
PMED4_00151 GO:0030150 PF01025 protein import into mitochondrial matrix 3.60134e-43
PMED4_00151 GO:0005739 PF01025 mitochondrion 3.60134e-43

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_00151 PF01025 GrpE GrpE 3.60134e-43

Enzyme Information
Protein EC Number Note
None None None

>PMED4_00151
MIEKQSDNVENLEDNVSQEVNKNEDSSVIENQTSEDKQTLEVDDENIYAEDLKNTITNNDARLEQLEKEHETLKSQYVRIAADFDNFRKRQSRDQDDLKV
QLVSKALTAILPIVDNFERARQQLKPESEEAQTLHRSYQGLYKQLVEVLKQQGVSPMRVVAQQFDPKLHEAVLREPSQEFNEDIIIEELQRGYHLEGKVL
RHALVKVSMGPGQQNSQEPEEKDKVEEDIDSENPISEEN

>PMED4_00151
ATGATTGAAAAACAATCAGATAATGTCGAAAATCTAGAAGATAATGTTTCTCAAGAGGTTAATAAAAATGAAGATTCCTCTGTGATTGAAAATCAAACCA
GCGAAGATAAACAGACACTAGAGGTAGATGATGAAAATATTTATGCAGAAGATTTAAAAAATACCATAACCAATAATGACGCAAGATTAGAACAATTAGA
AAAAGAGCATGAAACTTTAAAAAGTCAGTATGTAAGAATTGCTGCCGATTTCGATAACTTTAGAAAAAGACAGTCTCGAGATCAAGATGATTTAAAAGTT
CAACTTGTTTCCAAAGCTTTAACAGCAATATTGCCGATTGTTGATAATTTTGAAAGAGCAAGACAACAACTAAAACCCGAAAGTGAGGAGGCTCAAACAT
TGCACAGAAGTTATCAAGGACTATATAAACAATTAGTGGAAGTGTTAAAACAACAAGGAGTTTCTCCAATGAGGGTAGTTGCACAACAATTTGATCCTAA
GTTACATGAAGCGGTTTTAAGGGAACCAAGTCAGGAGTTTAATGAGGATATAATTATTGAAGAATTACAGCGTGGATATCATTTAGAAGGTAAGGTGTTA
AGACATGCATTAGTTAAAGTTTCAATGGGTCCTGGCCAACAAAATTCACAAGAGCCTGAAGAAAAGGATAAAGTTGAAGAAGATATTGATTCAGAGAATC
CTATCTCTGAAGAAAATTAA