logo
Affymetrix Probeset: MED4_ARR_0030_x_at
Probeset Position: 30235..30525(+)
Number of probes: 11

Microarray Data of MED4_ARR_0030_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 19.0 30.03 0.632701 -0.660405 0.0791
Phosphate Starvation P-depleted 4 h 10.26 11.8 0.869492 -0.201756 0.462
Phosphate Starvation P-depleted 12 h 13.5 13.99 0.964975 -0.051437 0.8262
Phosphate Starvation P-depleted 24 h 16.31 17.86 0.913214 -0.130975 0.815
Phosphate Starvation P-depleted 48 h 18.78 12.77 1.47063 0.556439 0.126
Nitrogen Availability N deprivation 0 h NA NA 0.993554 -0.00933 0.978187
Nitrogen Availability N deprivation 3 h NA NA 1.37824 0.46283 0.806242
Nitrogen Availability N deprivation 6 h NA NA 2.16493 1.11432 0.03169
Nitrogen Availability N deprivation 12 h NA NA 2.77979 1.47498 0.0
Nitrogen Availability N deprivation 24 h NA NA 12.2927 3.61973 0.0
Nitrogen Availability N deprivation 48 h NA NA 22.1072 4.46645 0.0
Nitrogen Availability Urea log phase NA NA 2.08992 1.06344 0.78954
Nitrogen Availability Cyanate log phase NA NA 1.87313 0.905448 0.953996
Light Sensing High light 45 min NA NA 1.0561 0.078746 0.0
Light Sensing White light 45 min NA NA 0.924 -0.114035 0.0
Light Sensing Blue light 45 min NA NA 0.7934 -0.33388 0.0
Light Sensing Red light 45 min NA NA 1.1039 0.142609 0.0
Light Sensing Green light 45 min NA NA 1.2199 0.286763 0.0
Light Sensing White light+DCMU 45 min NA NA 1.21986 0.286712 0.0
Iron Availability -Fe 0 h NA NA None -0.069452 0.937455
Iron Availability -Fe 12 h NA NA None 0.41684 0.096014
Iron Availability -Fe 24 h NA NA None 0.635987 0.00376
Iron Availability -Fe 48 h NA NA None 0.657183 0.001584
Iron Availability -Fe 70 h rescue NA NA None -0.85726 4.8e-05

Protein Info: PMED4_00291 possible Transcription factor TFIID (or TATA-b
COG

Location: 30235 - 30525 (+) on scaffold: NC_005072
Protein Length: 96 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_00291
Alternative Tag: PMM0030
MicrobesOnline ID: VIMSS565360
CyCOG: 2374(ID from pipeline) - 2374 (ID from previou versions)
CyCOG Size: 5

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0030_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_00291
MINWSLSIINSTYVLLKKMQTLIQPEVKLNIVGFDNSNFQVKEKLNYSKSCLDFKFYQKLFAIFLVSCAFLIFPESPQDSEILCKKYQSTKACMVW

>PMED4_00291
TTGATAAATTGGTCATTAAGTATTATAAATAGTACATATGTATTATTAAAGAAAATGCAGACTTTAATTCAGCCTGAGGTAAAACTAAATATAGTTGGTT
TTGATAATTCCAATTTTCAAGTTAAAGAAAAATTAAATTATTCAAAATCTTGTTTAGATTTTAAATTCTATCAAAAATTATTTGCAATATTTTTAGTATC
TTGTGCATTTTTAATATTTCCTGAATCTCCACAAGATTCAGAAATTTTATGCAAAAAATATCAATCTACAAAGGCTTGTATGGTCTGGTAA