logo
Affymetrix Probeset: MED4_ARR_0194_x_at
Probeset Position: 188883..190091(+)
Number of probes: 15

Microarray Data of MED4_ARR_0194_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 281.97 131.42 2.14556 1.10136 0.021
Phosphate Starvation P-depleted 4 h 432.65 302.25 1.43143 0.517458 0.2847
Phosphate Starvation P-depleted 12 h 232.97 177.37 1.31347 0.393382 0.3275
Phosphate Starvation P-depleted 24 h 287.9 264.83 1.08711 0.120501 0.768
Phosphate Starvation P-depleted 48 h 234.25 170.25 1.37592 0.460394 0.119
Nitrogen Availability N deprivation 0 h NA NA 0.732819 -0.448472 0.402772
Nitrogen Availability N deprivation 3 h NA NA 1.09607 0.132342 0.964458
Nitrogen Availability N deprivation 6 h NA NA 0.662043 -0.595004 0.276471
Nitrogen Availability N deprivation 12 h NA NA 0.515523 -0.955892 0.148467
Nitrogen Availability N deprivation 24 h NA NA 0.835836 -0.258709 0.890402
Nitrogen Availability N deprivation 48 h NA NA 0.838912 -0.253408 0.795078
Nitrogen Availability Urea log phase NA NA 0.884455 -0.17714 0.878951
Nitrogen Availability Cyanate log phase NA NA 1.04237 0.059864 0.990024
Light Sensing High light 45 min NA NA 5.9449 2.57165 0.0
Light Sensing White light 45 min NA NA 4.7008 2.23291 0.0
Light Sensing Blue light 45 min NA NA 5.6956 2.50985 0.0
Light Sensing Red light 45 min NA NA 2.8706 1.52135 0.0
Light Sensing Green light 45 min NA NA 0.4609 -1.11747 0.0
Light Sensing White light+DCMU 45 min NA NA 0.460924 -1.1174 0.0
Iron Availability -Fe 0 h NA NA None 0.070389 0.922326
Iron Availability -Fe 12 h NA NA None 0.24732 0.249125
Iron Availability -Fe 24 h NA NA None -0.204233 0.177652
Iron Availability -Fe 48 h NA NA None -0.042457 0.467349
Iron Availability -Fe 70 h rescue NA NA None 0.280956 0.010897

Protein Info: PMED4_02011 Phosphoglycerate kinase (pgk)
COG

Location: 188883 - 190091 (+) on scaffold: NC_005072
Protein Length: 402 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_02011
Alternative Tag: PMM0195
MicrobesOnline ID: VIMSS565528
CyCOG: 2546(ID from pipeline) - 2546 (ID from previou versions)
CyCOG Size: 24
NCBI COG: COG126

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0194_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_02011 GO:0004618 PF00162 phosphoglycerate kinase activity 0.0
PMED4_02011 GO:0006096 PF00162 glycolysis 0.0

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_02011 PF00162 PGK Phosphoglycerate kinase 0.0

Enzyme Information
Protein EC Number Note
PMED4_02011 EC:2.7.2.3 Annotated recently

>PMED4_02011
MSKLSLSSLDKSKLEGKKVLVRVDFNVPLNDSGQITDDTRIRAAIPTIKYLINNSAKVILAAHFGRPKGKVNEKMRLTPVAARLSDILEQKVNLTESCIG
EEALAKSNSLNNGEVLLLENVRFYEEEEKNDLDFAKNLASHADMYVNDAFGAAHRAHASTQGVTKFLEPAVAGFLLEKELKYLQGAIDAPKRPLAAIVGG
SKVSSKIGVLDSLLDKCDKIIIGGGMIFTFYKARGLDVGKSLVEEDKLELARNLEAKAKNKGVELLLPSDVLLANEFSPDAESKVSQIDAISGDWMGLDI
GPQSIKVFQNALAECKTIIWNGPMGVFEFDKFAEGTNAIATTLADLSSFSEVCTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKTLPGVAALK
DA

>PMED4_02011
ATGTCGAAGTTGTCTCTTTCCAGTCTTGATAAGTCTAAATTAGAAGGAAAAAAAGTTCTTGTAAGGGTTGATTTTAATGTCCCATTAAATGACAGTGGTC
AAATTACTGATGATACTAGAATAAGAGCAGCAATTCCTACGATAAAATATCTTATAAATAATTCGGCAAAAGTTATATTAGCTGCTCATTTTGGAAGACC
TAAAGGGAAAGTTAATGAGAAAATGAGATTAACCCCAGTTGCTGCCAGATTAAGCGATATCTTGGAACAAAAAGTTAATCTGACTGAAAGCTGCATTGGT
GAAGAGGCTCTAGCTAAATCTAATAGTTTAAACAATGGGGAGGTTTTATTACTAGAAAATGTTCGTTTTTATGAAGAAGAAGAAAAAAATGATTTAGATT
TCGCTAAAAATTTAGCTTCTCATGCAGATATGTATGTTAACGATGCTTTTGGAGCTGCGCATAGAGCTCATGCTTCAACTCAAGGAGTTACAAAATTTTT
AGAACCTGCTGTTGCAGGATTTTTGTTAGAAAAAGAGTTGAAATATTTACAGGGCGCAATTGATGCTCCAAAACGTCCTCTTGCAGCAATAGTAGGAGGT
TCTAAAGTAAGTAGCAAAATTGGAGTTTTGGATTCTCTTTTAGATAAGTGTGACAAAATTATTATTGGGGGCGGTATGATTTTTACTTTTTACAAGGCAA
GAGGATTAGATGTTGGGAAGAGTCTTGTTGAGGAAGATAAACTCGAACTAGCAAGAAATTTAGAGGCAAAAGCAAAAAATAAAGGGGTAGAGCTTCTATT
ACCATCTGATGTATTACTTGCAAATGAGTTTTCTCCTGATGCAGAAAGTAAAGTCTCTCAAATAGATGCAATAAGTGGTGATTGGATGGGCCTAGACATT
GGGCCACAATCAATCAAGGTTTTCCAAAATGCTCTTGCCGAATGTAAAACAATAATTTGGAATGGTCCAATGGGTGTTTTTGAATTTGATAAATTTGCTG
AAGGTACAAATGCAATAGCAACAACCCTGGCAGATTTAAGTTCTTTCTCTGAGGTTTGTACAATTATTGGAGGGGGAGATTCTGTCGCTGCAGTAGAAAA
AGCTGGCTTAGCTGAAAAAATGTCACATATATCTACTGGTGGAGGGGCTAGTTTAGAACTTTTAGAAGGCAAAACTTTACCTGGAGTAGCAGCTTTAAAA
GACGCTTAA