logo
Affymetrix Probeset: MED4_ARR_0313_x_at
Probeset Position: 301064..302587(-)
Number of probes: 19

Microarray Data of MED4_ARR_0313_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 2003.0 1275.5 1.57036 0.6511 0.0384
Phosphate Starvation P-depleted 4 h 5041.0 5355.0 0.941363 -0.087177 0.5593
Phosphate Starvation P-depleted 12 h 5825.33 5500.67 1.05902 0.082733 0.7568
Phosphate Starvation P-depleted 24 h 6399.67 5947.67 1.076 0.105673 0.731
Phosphate Starvation P-depleted 48 h 5703.5 5528.0 1.03175 0.04509 0.264
Nitrogen Availability N deprivation 0 h NA NA 1.2483 0.31996 0.388576
Nitrogen Availability N deprivation 3 h NA NA 1.02861 0.040695 0.988372
Nitrogen Availability N deprivation 6 h NA NA 0.827689 -0.272839 0.638279
Nitrogen Availability N deprivation 12 h NA NA 0.402804 -1.31185 0.01699
Nitrogen Availability N deprivation 24 h NA NA 0.349303 -1.51745 0.0
Nitrogen Availability N deprivation 48 h NA NA 0.154941 -2.69021 0.005128
Nitrogen Availability Urea log phase NA NA 0.855441 -0.22526 0.703113
Nitrogen Availability Cyanate log phase NA NA 0.687898 -0.539734 0.070175
Light Sensing High light 45 min NA NA 0.6029 -0.730009 0.0
Light Sensing White light 45 min NA NA 1.2353 0.304861 0.0
Light Sensing Blue light 45 min NA NA 0.9103 -0.135586 0.0
Light Sensing Red light 45 min NA NA 1.122 0.166073 0.0
Light Sensing Green light 45 min NA NA 0.9601 -0.058743 0.0
Light Sensing White light+DCMU 45 min NA NA 0.960079 -0.058775 0.0
Iron Availability -Fe 0 h NA NA None -0.258425 0.795429
Iron Availability -Fe 12 h NA NA None -0.234465 0.226661
Iron Availability -Fe 24 h NA NA None -0.311148 0.057541
Iron Availability -Fe 48 h NA NA None -0.426625 0.018975
Iron Availability -Fe 70 h rescue NA NA None 0.585924 0.000275

Protein Info: PMED4_03211 Photosystem II PsbB protein (CP47) (psbB)
COG

Location: 301064 - 302587 (-) on scaffold: NC_005072
Protein Length: 507 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_03211
Alternative Tag: PMM0315
MicrobesOnline ID: VIMSS565652
CyCOG: 2666(ID from pipeline) - 2666 (ID from previou versions)
CyCOG Size: 24

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0313_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_03211 GO:0016168 PF00421 chlorophyll binding 0.0
PMED4_03211 GO:0009767 PF00421 photosynthetic electron transport chain 0.0
PMED4_03211 GO:0019684 PF00421 "photosynthesis, light reaction" 0.0
PMED4_03211 GO:0009521 PF00421 photosystem 0.0
PMED4_03211 GO:0016020 PF00421 membrane 0.0

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_03211 PF00421 PSII Photosystem II protein 0.0

Enzyme Information
Protein EC Number Note
None None None

>PMED4_03211
MGLPWYRVHTVVINDPGRLLAVHLMHTALLAGWAGSMALYELAIFDPSDAVLNPMWRQGMYVMPFMARLGITSSWNGWDITGATGVDPGFWSFEGVAAAH
IVFSGLLMLASIWHWTYWDLDLWEDERTGEPALDLPRIFGIHLLLSGITCFGFGAFHCANVGIWISDPYGLTGHVEQVAPSWGADGFNPFNPGGIVANHI
AAGLLGIIGGIFHITNRPGERLYRALKLGSLEGVLASALAAVLFVSFVVAGTMWYGSATTPIELFGPTRYQWDSGYFKTEINRRVQTAIDNGATKEEAYA
SIPEKLAFYDYVGNSPAKGGLFRVGALVNGDGLPTGWQGHIAFTDKEGNDLEVRRIPNFFENFPVILEDKEGNVRADIPFRRAEAKYSFEQTGITATIYG
GDLNGQTFTDPAVVKRLARKAQLGEAFKFDRETYKSDGVFRSSPRAWFTYAHLCFGLLFLFGHWWHASRTLYKDSFAGIDSEIGDQVEFGLFKKLGDETT
RRIPGRV

>PMED4_03211
ATGGGATTGCCTTGGTATAGAGTTCACACAGTAGTTATCAACGACCCCGGTCGACTACTTGCTGTGCATCTCATGCATACTGCATTATTAGCCGGCTGGG
CCGGTTCTATGGCTTTATATGAATTAGCCATTTTTGATCCTTCAGACGCTGTTCTCAATCCAATGTGGAGACAGGGAATGTATGTCATGCCATTCATGGC
GAGATTAGGGATCACAAGTAGTTGGAACGGATGGGATATAACTGGTGCTACAGGGGTTGATCCAGGATTCTGGAGCTTCGAAGGTGTTGCAGCCGCTCAC
ATTGTTTTTAGTGGACTTTTAATGCTTGCTTCAATCTGGCATTGGACATATTGGGATTTAGATCTATGGGAAGATGAAAGAACTGGAGAACCTGCTCTTG
ATCTCCCAAGGATATTTGGGATTCATCTTCTCTTATCAGGTATTACTTGCTTTGGATTTGGAGCTTTTCATTGCGCGAATGTCGGCATTTGGATTTCAGA
TCCATATGGTTTAACTGGTCATGTCGAACAGGTAGCACCATCTTGGGGAGCAGATGGATTTAATCCCTTTAATCCTGGTGGAATAGTTGCAAATCATATT
GCAGCTGGCCTTTTGGGTATTATTGGTGGAATATTTCACATCACAAATAGACCTGGAGAAAGGCTTTATAGAGCCCTTAAGCTTGGAAGTTTGGAAGGAG
TATTAGCTAGTGCTCTTGCCGCTGTTCTATTTGTATCTTTTGTTGTCGCAGGAACAATGTGGTACGGCTCTGCCACCACTCCTATTGAATTGTTTGGACC
AACAAGATATCAATGGGACTCAGGTTACTTCAAAACTGAAATAAACAGGAGAGTTCAAACAGCTATTGATAATGGAGCAACTAAGGAAGAAGCATATGCT
TCAATTCCAGAAAAGCTTGCATTCTACGATTATGTAGGGAACAGCCCTGCTAAAGGAGGATTGTTTAGGGTTGGTGCTCTTGTAAATGGAGATGGTTTAC
CAACAGGCTGGCAAGGTCATATTGCCTTTACTGATAAAGAGGGCAATGATTTAGAAGTTAGAAGAATTCCAAACTTCTTTGAAAACTTCCCTGTTATTTT
GGAAGACAAGGAAGGGAATGTGAGAGCTGACATCCCATTTAGAAGGGCTGAAGCAAAGTATTCATTTGAACAAACTGGCATCACAGCGACTATTTATGGA
GGTGATCTTAATGGTCAAACATTCACAGATCCTGCTGTAGTTAAAAGATTAGCTAGGAAAGCACAACTTGGCGAAGCATTCAAGTTTGATAGAGAAACTT
ATAAATCTGATGGTGTATTCCGAAGTTCCCCTAGAGCTTGGTTTACTTATGCACATTTATGTTTCGGCTTATTATTCTTATTTGGTCATTGGTGGCATGC
TTCGAGAACACTTTACAAAGACTCCTTTGCTGGTATTGACTCTGAGATAGGTGATCAAGTTGAATTTGGTCTCTTTAAGAAACTTGGAGACGAAACCACT
AGACGAATCCCAGGAAGGGTTTAA