logo
Affymetrix Probeset: MED4_ARR_0347_x_at
Probeset Position: 334132..334548(+)
Number of probes: 10

Microarray Data of MED4_ARR_0347_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 7.61 15.1 0.503973 -0.98858 0.021
Phosphate Starvation P-depleted 4 h 6.28 5.23 1.20076 0.263954 0.3502
Phosphate Starvation P-depleted 12 h 8.22 6.93 1.18615 0.246283 0.4827
Phosphate Starvation P-depleted 24 h 10.23 12.08 0.846854 -0.239814 0.75
Phosphate Starvation P-depleted 48 h 6.61 5.2 1.27115 0.346139 0.126
Nitrogen Availability N deprivation 0 h NA NA 1.06224 0.087106 0.848183
Nitrogen Availability N deprivation 3 h NA NA 0.821409 -0.283827 0.907034
Nitrogen Availability N deprivation 6 h NA NA 1.02855 0.040618 0.958134
Nitrogen Availability N deprivation 12 h NA NA 0.692895 -0.529292 0.485375
Nitrogen Availability N deprivation 24 h NA NA 0.407822 -1.29399 0.82462
Nitrogen Availability N deprivation 48 h NA NA 0.601408 -0.733584 0.630224
Nitrogen Availability Urea log phase NA NA 1.16987 0.226347 0.960128
Nitrogen Availability Cyanate log phase NA NA 0.988218 -0.017099 0.99908
Light Sensing High light 45 min NA NA 1.1083 0.148348 0.0
Light Sensing White light 45 min NA NA 1.1672 0.223052 0.0
Light Sensing Blue light 45 min NA NA 0.9673 -0.047965 0.0
Light Sensing Red light 45 min NA NA 1.0253 0.036046 0.0
Light Sensing Green light 45 min NA NA 0.9106 -0.135111 0.0
Light Sensing White light+DCMU 45 min NA NA 0.910606 -0.135101 0.0
Iron Availability -Fe 0 h NA NA None 0.302173 0.87913
Iron Availability -Fe 12 h NA NA None 0.54201 0.41879
Iron Availability -Fe 24 h NA NA None 0.199123 0.443852
Iron Availability -Fe 48 h NA NA None 0.545968 0.071219
Iron Availability -Fe 70 h rescue NA NA None -0.72977 0.011365

Protein Info: PMED4_03671 Class I peptide chain release factor
COG

Location: 334132 - 334548 (+) on scaffold: NC_005072
Protein Length: 138 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_03671
Alternative Tag: PMM0349
MicrobesOnline ID: VIMSS565693
CyCOG: 2712(ID from pipeline) - 2712 (ID from previou versions)
CyCOG Size: 23

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0347_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_03671 GO:0003747 PF00472 translation release factor activity 3.7e-23
PMED4_03671 GO:0006415 PF00472 translational termination 3.7e-23

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_03671 PF00472 RF-1 RF-1 domain 3.7e-23

Enzyme Information
Protein EC Number Note
None None None

>PMED4_03671
MDLIITSRLVIPSKELKWRFSRSSGPGGQKVNKTNTRVEIIFNIEESKVLNDYQKKVLTKKLKTKLVNNCICLAVQEERNQLLNRQIAIKRISSVIRNSL
KNSSKIRKATKPSKASQNRRLDSKKKRGELKKNRQIKY

>PMED4_03671
ATGGATTTAATTATTACTTCCAGATTAGTAATTCCTTCAAAAGAATTAAAATGGCGTTTTTCTAGATCATCTGGCCCGGGAGGTCAAAAAGTAAATAAAA
CTAATACTAGAGTAGAAATTATTTTTAATATCGAAGAATCAAAAGTCTTAAATGATTATCAAAAGAAAGTTTTAACGAAAAAATTGAAAACCAAATTAGT
CAATAACTGTATATGTCTAGCCGTCCAGGAAGAAAGGAATCAATTACTTAATAGACAAATAGCTATAAAAAGAATTAGCTCAGTAATTAGAAATTCCTTA
AAAAATTCATCCAAAATTAGAAAAGCTACAAAACCATCTAAAGCTTCTCAAAATAGAAGGCTTGACTCCAAAAAAAAACGGGGAGAACTAAAAAAGAATC
GACAAATAAAATATTAA