logo
Affymetrix Probeset: MED4_ARR_0360_x_at
Probeset Position: 344969..345265(+)
Number of probes: 10

Microarray Data of MED4_ARR_0360_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 5.13 5.94 0.863636 -0.211504 0.3604
Phosphate Starvation P-depleted 4 h 6.2 5.09 1.21807 0.284602 0.3556
Phosphate Starvation P-depleted 12 h 5.15 5.6 0.919643 -0.120854 0.6976
Phosphate Starvation P-depleted 24 h 5.04 5.64 0.893617 -0.162271 0.735
Phosphate Starvation P-depleted 48 h 5.09 5.07 1.00394 0.00568 0.283
Nitrogen Availability N deprivation 0 h NA NA 1.10041 0.138047 0.929144
Nitrogen Availability N deprivation 3 h NA NA 1.91151 0.934711 0.891129
Nitrogen Availability N deprivation 6 h NA NA 1.50624 0.590954 0.80291
Nitrogen Availability N deprivation 12 h NA NA 0.820053 -0.286211 0.810576
Nitrogen Availability N deprivation 24 h NA NA 0.642837 -0.637475 0.937065
Nitrogen Availability N deprivation 48 h NA NA 0.551319 -0.85904 0.616391
Nitrogen Availability Urea log phase NA NA 1.00445 0.006412 0.998175
Nitrogen Availability Cyanate log phase NA NA 1.35559 0.438924 0.985274
Light Sensing High light 45 min NA NA 0.9398 -0.089574 0.0
Light Sensing White light 45 min NA NA 0.9374 -0.093263 0.0
Light Sensing Blue light 45 min NA NA 1.0576 0.080794 0.0
Light Sensing Red light 45 min NA NA 0.9884 -0.016833 0.0
Light Sensing Green light 45 min NA NA 1.021 0.029983 0.0
Light Sensing White light+DCMU 45 min NA NA 1.02102 0.030014 0.0
Iron Availability -Fe 0 h NA NA None -0.042457 0.941026
Iron Availability -Fe 12 h NA NA None 1.492622 0.003734
Iron Availability -Fe 24 h NA NA None 2.652831 1.1e-05
Iron Availability -Fe 48 h NA NA None 3.404086 2e-06
Iron Availability -Fe 70 h rescue NA NA None -4.058894 0.0

Protein Info: PMED4_03871 hypothetical
COG

Location: 344969 - 345265 (+) on scaffold: NC_005072
Protein Length: 98 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_03871
Alternative Tag: PMM0362
MicrobesOnline ID: VIMSS565706
CyCOG: 2732(ID from pipeline) - 2732 (ID from previou versions)
CyCOG Size: 4

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0360_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_03871
MKIMDNFDDDLSLKQKEFVEPIDKATNKDLFEKKDEFKEATPKVLHLNSLITKNIYLFTKDPNYKLFAWLMVQLFIFSLFVLVATLMKNNLVPYINSL

>PMED4_03871
ATGAAGATTATGGATAATTTTGATGATGATCTTTCTTTAAAACAAAAAGAATTTGTAGAGCCTATAGATAAAGCTACAAATAAAGATTTATTTGAAAAAA
AAGATGAATTTAAAGAGGCAACTCCAAAAGTTCTTCATCTTAATTCACTTATTACAAAAAATATTTATCTTTTTACAAAAGATCCAAACTATAAATTGTT
TGCCTGGCTAATGGTTCAGCTATTTATATTTTCATTATTTGTTTTGGTGGCGACATTAATGAAAAATAATCTTGTCCCCTATATTAATTCTCTTTAA