logo
Affymetrix Probeset: MED4_ARR_0368_x_at
Probeset Position: 352975..354660(+)
Number of probes: 21

Microarray Data of MED4_ARR_0368_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 126.44 245.8 0.514402 -0.959032 0.021
Phosphate Starvation P-depleted 4 h 179.8 238.4 0.754195 -0.406991 0.3559
Phosphate Starvation P-depleted 12 h 229.23 232.3 0.986784 -0.019193 0.8901
Phosphate Starvation P-depleted 24 h 221.63 288.9 0.767151 -0.382417 0.469
Phosphate Starvation P-depleted 48 h 124.65 165.75 0.752036 -0.411126 0.132
Nitrogen Availability N deprivation 0 h NA NA 1.09867 0.135752 0.781789
Nitrogen Availability N deprivation 3 h NA NA 19.8153 4.30854 0.0
Nitrogen Availability N deprivation 6 h NA NA 53.0208 5.72849 0.0
Nitrogen Availability N deprivation 12 h NA NA 23.9757 4.5835 0.0
Nitrogen Availability N deprivation 24 h NA NA 16.7321 4.06455 0.0
Nitrogen Availability N deprivation 48 h NA NA 15.0721 3.91381 0.0
Nitrogen Availability Urea log phase NA NA 0.480894 -1.05621 0.540299
Nitrogen Availability Cyanate log phase NA NA 2.25192 1.17116 0.042553
Light Sensing High light 45 min NA NA 0.649 -0.62371 0.0
Light Sensing White light 45 min NA NA 0.9195 -0.121079 0.0
Light Sensing Blue light 45 min NA NA 1.081 0.112366 0.0
Light Sensing Red light 45 min NA NA 0.7573 -0.401063 0.0
Light Sensing Green light 45 min NA NA 0.6552 -0.609993 0.0
Light Sensing White light+DCMU 45 min NA NA 0.655163 -0.610075 0.0
Iron Availability -Fe 0 h NA NA None -0.004335 0.949884
Iron Availability -Fe 12 h NA NA None 0.291604 0.090782
Iron Availability -Fe 24 h NA NA None 0.559737 0.006952
Iron Availability -Fe 48 h NA NA None 0.752749 0.000615
Iron Availability -Fe 70 h rescue NA NA None -1.101598 5e-06

Protein Info: PMED4_04031 putative cyanate ABC transporter, substrate binding protein
COG

Location: 352975 - 354660 (+) on scaffold: NC_005072
Protein Length: 561 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_04031
Alternative Tag: PMM0370
MicrobesOnline ID: VIMSS565714
CyCOG: 2748(ID from pipeline) - 2748 (ID from previou versions)
CyCOG Size: 2
NCBI COG: COG715

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0368_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_04031 PF09084 NMT1 NMT1/THI5 like 2.8e-06

Enzyme Information
Protein EC Number Note
None None None

>PMED4_04031
MLNPVNNSTKKYNFKCGPSSADNSDQFQDNSQNSLNNLLNPANNHGYLCACVECRPIGNDHENFMSDMPDDPVEIISDFSRMGLIKNQAYEVADAISTAE
MRDLLFYKNASNGDPYKEKLLRELAKEAGGLDQAFRAAFGPQAGKFFANTRASSPMGRRAFLSSLAAGAALITVACSNQNKPTKQPIDDTPININNLEKQ
TLRVGFIPITCASPIIMAEPMGFYNKFGMDVKVVKMPSWGAVRDSAIAGELDAYHMLAPMPISMTLGLGTSPFSVKLASIENINGQAITVANRHKGKVKG
PADMKGFIFGVPFPYSMHNLLLRYYLAKGGVDPDKDVQIRPVPPPDSIAQLVAGDIDAYLMPDPFNQRAVYEDAGFIHLLTKELWPGHPCCAFAAGEPWI
NEHPETFRALNKSIIDAAAYVSTPSNRKEVAKAISGRGFLNQPTEVVEAVLTGKFEDGLGKTQNVPDRIDFKPYPWQSFSHWIQSQLIRWDLGGAVAAIQ
AGDFNPNSASIFLTDEAQALEREMGGNPPTARFRKEVLAYDEFDPSNPIKYVKDQIKRDGF

>PMED4_04031
ATGCTTAATCCAGTAAATAATTCTACTAAAAAGTATAATTTTAAATGTGGTCCCTCATCTGCAGATAATTCAGATCAGTTCCAAGATAATTCTCAAAATT
CATTAAATAATCTTTTAAATCCAGCTAATAATCATGGATATTTGTGTGCATGCGTTGAATGCAGACCAATAGGTAATGATCATGAAAACTTCATGTCAGA
TATGCCGGACGATCCAGTAGAGATAATATCTGATTTTTCTCGCATGGGTCTTATCAAAAATCAGGCTTACGAAGTAGCTGATGCCATTTCTACTGCAGAA
ATGCGAGATCTTTTATTCTACAAAAATGCATCTAATGGTGATCCTTATAAAGAGAAATTATTAAGAGAATTAGCTAAAGAGGCTGGTGGATTAGATCAAG
CATTTAGAGCTGCCTTTGGACCTCAAGCAGGTAAGTTTTTTGCAAATACAAGGGCTTCATCTCCTATGGGTAGGAGAGCTTTTTTATCGAGTCTTGCAGC
AGGTGCAGCTTTAATTACAGTAGCTTGTTCTAATCAAAATAAACCTACAAAACAACCTATTGATGATACACCGATAAATATTAATAACTTAGAAAAACAA
ACTTTACGAGTTGGTTTTATCCCAATAACATGTGCTTCGCCAATCATTATGGCAGAACCAATGGGCTTTTATAACAAGTTTGGAATGGATGTCAAAGTTG
TTAAAATGCCAAGCTGGGGAGCTGTAAGAGATTCTGCCATAGCAGGTGAATTAGATGCTTACCATATGCTAGCTCCGATGCCAATTTCTATGACTCTTGG
TCTAGGAACTTCACCATTTAGCGTAAAACTAGCAAGTATTGAAAATATTAATGGTCAAGCAATTACTGTTGCTAATCGTCATAAAGGCAAAGTAAAAGGA
CCTGCGGATATGAAAGGCTTCATTTTTGGAGTCCCTTTCCCTTATTCAATGCATAATCTTCTTTTGAGATATTATCTTGCAAAAGGTGGTGTTGATCCAG
ATAAAGACGTTCAAATTCGTCCTGTTCCACCCCCAGATAGTATTGCTCAATTAGTTGCAGGTGATATTGATGCTTACTTAATGCCTGATCCATTTAACCA
AAGAGCCGTTTATGAAGATGCAGGATTCATTCATCTTCTTACAAAAGAATTATGGCCTGGTCATCCATGCTGTGCATTTGCAGCAGGAGAGCCTTGGATA
AATGAGCACCCTGAAACTTTTAGAGCGCTCAATAAATCAATTATCGATGCGGCAGCCTATGTTTCAACACCTTCAAATAGAAAGGAGGTAGCTAAGGCTA
TTTCGGGAAGAGGTTTTTTAAATCAACCTACTGAAGTTGTTGAAGCAGTTCTTACAGGTAAATTTGAAGACGGATTAGGTAAAACTCAAAACGTGCCTGA
CCGAATTGATTTTAAACCTTATCCTTGGCAGAGTTTTTCTCATTGGATACAATCTCAGCTTATAAGATGGGATCTAGGAGGGGCTGTAGCGGCTATTCAG
GCTGGTGATTTTAACCCAAATAGTGCCTCTATTTTTCTAACTGATGAAGCTCAGGCATTAGAAAGAGAAATGGGAGGTAATCCACCTACCGCTAGGTTTA
GAAAAGAAGTTTTGGCTTATGATGAATTTGATCCAAGTAATCCAATCAAATATGTCAAAGATCAAATAAAAAGAGACGGTTTCTAA