logo
Affymetrix Probeset: MED4_ARR_0461_x_at
Probeset Position: 441435..441752(+)
Number of probes: 11

Microarray Data of MED4_ARR_0461_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 19.16 23.4 0.818803 -0.288411 0.4087
Phosphate Starvation P-depleted 4 h 17.94 14.62 1.22709 0.295237 0.4599
Phosphate Starvation P-depleted 12 h 19.08 19.54 0.976458 -0.034369 0.8901
Phosphate Starvation P-depleted 24 h 22.96 29.73 0.772284 -0.372797 0.634
Phosphate Starvation P-depleted 48 h 20.81 14.6 1.42534 0.511309 0.126
Nitrogen Availability N deprivation 0 h NA NA 0.745678 -0.423375 0.488928
Nitrogen Availability N deprivation 3 h NA NA 0.898352 -0.154647 0.960196
Nitrogen Availability N deprivation 6 h NA NA 1.42882 0.514823 0.561088
Nitrogen Availability N deprivation 12 h NA NA 2.33214 1.22165 0.030675
Nitrogen Availability N deprivation 24 h NA NA 1.09593 0.132156 0.954431
Nitrogen Availability N deprivation 48 h NA NA 1.15853 0.212294 0.828947
Nitrogen Availability Urea log phase NA NA 0.820681 -0.285107 0.887393
Nitrogen Availability Cyanate log phase NA NA 1.28155 0.357887 0.963817
Light Sensing High light 45 min NA NA 1.1781 0.236462 0.0
Light Sensing White light 45 min NA NA 1.0921 0.127105 0.0
Light Sensing Blue light 45 min NA NA 0.9448 -0.081919 0.0
Light Sensing Red light 45 min NA NA 0.9215 -0.117944 0.0
Light Sensing Green light 45 min NA NA 0.8546 -0.226679 0.0
Light Sensing White light+DCMU 45 min NA NA 0.854607 -0.226667 0.0
Iron Availability -Fe 0 h NA NA None 0.107018 0.923583
Iron Availability -Fe 12 h NA NA None 1.246104 0.00017
Iron Availability -Fe 24 h NA NA None 1.435629 4.9e-05
Iron Availability -Fe 48 h NA NA None 1.712816 5e-06
Iron Availability -Fe 70 h rescue NA NA None -2.035047 0.0

Protein Info: PMED4_05111 conserved hypothetical protein
COG

Location: 441435 - 441752 (+) on scaffold: NC_005072
Protein Length: 105 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_05111
Alternative Tag: PMM0463
MicrobesOnline ID: VIMSS565809
CyCOG: 2856(ID from pipeline) - 2856 (ID from previou versions)
CyCOG Size: 21

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0461_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_05111 PF11267 DUF3067 Protein of unknown function (DUF3067) 4.2e-39

Enzyme Information
Protein EC Number Note
None None None

>PMED4_05111
MKPLVVDEIIHYLIHRWGKKYDFRLFKRGKYLYFQMMWGFLGQESFPLNEVEYKKSIADKIEILNRCGYSDEVREWLKKVNSKPRLGRAVSLQLHINERM
KEFLI

>PMED4_05111
ATGAAACCTTTGGTAGTAGATGAGATTATCCATTACTTGATTCATCGATGGGGTAAAAAATATGACTTTAGACTTTTTAAAAGAGGAAAATATTTATATT
TTCAAATGATGTGGGGTTTTTTAGGACAAGAATCTTTTCCATTAAATGAAGTGGAATATAAAAAATCAATAGCAGATAAAATTGAAATATTAAATAGATG
CGGTTATTCAGATGAAGTAAGGGAATGGCTTAAAAAAGTAAATTCAAAACCAAGATTAGGAAGAGCTGTAAGCCTTCAACTACACATTAATGAGAGGATG
AAAGAGTTTTTGATTTAA