logo
Affymetrix Probeset: MED4_ARR_0548_x_at
Probeset Position: 520592..520933(+)
Number of probes: 11

Microarray Data of MED4_ARR_0548_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 197.5 463.2 0.426382 -1.22978 0.0068
Phosphate Starvation P-depleted 4 h 2801.0 4526.0 0.618869 -0.692295 0.0733
Phosphate Starvation P-depleted 12 h 1458.0 1947.0 0.748844 -0.417262 0.2073
Phosphate Starvation P-depleted 24 h 1727.67 1702.67 1.01468 0.021029 0.872
Phosphate Starvation P-depleted 48 h 1168.0 2151.0 0.543003 -0.880967 0.0378
Nitrogen Availability N deprivation 0 h NA NA 1.84345 0.882408 0.027273
Nitrogen Availability N deprivation 3 h NA NA 0.477334 -1.06693 0.744921
Nitrogen Availability N deprivation 6 h NA NA 0.163437 -2.61319 0.0
Nitrogen Availability N deprivation 12 h NA NA 0.048011 -4.3805 0.0
Nitrogen Availability N deprivation 24 h NA NA 0.144219 -2.79367 0.0
Nitrogen Availability N deprivation 48 h NA NA 0.065007 -3.94326 0.0
Nitrogen Availability Urea log phase NA NA 0.80842 -0.306822 0.576592
Nitrogen Availability Cyanate log phase NA NA 0.519081 -0.945967 0.0
Light Sensing High light 45 min NA NA 1.953 0.965692 0.0
Light Sensing White light 45 min NA NA 1.5879 0.66712 0.0
Light Sensing Blue light 45 min NA NA 1.3474 0.430178 0.0
Light Sensing Red light 45 min NA NA 1.204 0.267835 0.0
Light Sensing Green light 45 min NA NA 0.8453 -0.242465 0.0
Light Sensing White light+DCMU 45 min NA NA 0.845322 -0.242426 0.0
Iron Availability -Fe 0 h NA NA None -0.369595 0.846641
Iron Availability -Fe 12 h NA NA None 0.508936 0.039193
Iron Availability -Fe 24 h NA NA None 0.355016 0.115917
Iron Availability -Fe 48 h NA NA None 0.769772 0.006074
Iron Availability -Fe 70 h rescue NA NA None 0.159629 0.201756

Protein Info: PMED4_06001 Ribulose bisphosphate carboxylase, small chain (rbcS)
COG

Location: 520592 - 520933 (+) on scaffold: NC_005072
Protein Length: 113 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_06001
Alternative Tag: PMM0551
MicrobesOnline ID: VIMSS565899
CyCOG: 2945(ID from pipeline) - 2945 (ID from previou versions)
CyCOG Size: 24
NCBI COG: COG4451

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0548_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_06001 GO:0016984 PF00101 ribulose-bisphosphate carboxylase activity 4.8e-31
PMED4_06001 GO:0015977 PF00101 carbon fixation 4.8e-31

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_06001 PF00101 RuBisCO_small "Ribulose bisphosphate carboxylase, small chain" 4.8e-31

Enzyme Information
Protein EC Number Note
PMED4_06001 EC:4.1.1.39 Annotated recently

>PMED4_06001
MPFQSSVGDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWSYWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIIGYDAYT
QSQGTAFAVFQGR

>PMED4_06001
ATGCCTTTCCAGAGCTCAGTTGGTGACTATCAAACAGTTGCTACCCTGGAAACATTCGGTTTTTTACCACCGATGACCCAGGAAGAAATATACGATCAAA
TTGCCTACATTATTGCTCAAGGATGGAGTCCTGTTATTGAGCATGTACATCCAAGTGGAAGTATGCAAACTTATTGGTCTTATTGGAAGCTCCCTTTCTT
TGGGGAAAAAGATCTTAACTTGGTTGTAAGTGAGTTAGAAGCATGCCATAGAGCATACCCTGATCATCACGTAAGAATCATTGGTTATGACGCTTATACA
CAAAGTCAAGGTACAGCTTTTGCAGTTTTCCAAGGACGCTAA