logo
Affymetrix Probeset: MED4_ARR_0655_x_at
Probeset Position: 624955..625677(+)
Number of probes: 11

Microarray Data of MED4_ARR_0655_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 14.63 21.71 0.673883 -0.56943 0.0904
Phosphate Starvation P-depleted 4 h 21.65 11.88 1.82239 0.865832 0.2258
Phosphate Starvation P-depleted 12 h 12.65 12.86 0.98367 -0.023753 0.8901
Phosphate Starvation P-depleted 24 h 14.66 18.59 0.788596 -0.342642 0.688
Phosphate Starvation P-depleted 48 h 17.8 12.66 1.406 0.4916 0.126
Nitrogen Availability N deprivation 0 h NA NA 0.646962 -0.628248 0.514878
Nitrogen Availability N deprivation 3 h NA NA 0.547873 -0.868087 0.824277
Nitrogen Availability N deprivation 6 h NA NA 0.86846 -0.203468 0.831454
Nitrogen Availability N deprivation 12 h NA NA 0.506265 -0.982035 0.28915
Nitrogen Availability N deprivation 24 h NA NA 0.698657 -0.517344 0.891328
Nitrogen Availability N deprivation 48 h NA NA 0.632761 -0.660267 0.631833
Nitrogen Availability Urea log phase NA NA 1.58435 0.663891 0.862923
Nitrogen Availability Cyanate log phase NA NA 1.48585 0.571286 0.968117
Light Sensing High light 45 min NA NA 1.3698 0.453965 0.0
Light Sensing White light 45 min NA NA 1.1256 0.170694 0.0
Light Sensing Blue light 45 min NA NA 1.0232 0.033088 0.0
Light Sensing Red light 45 min NA NA 1.1279 0.173639 0.0
Light Sensing Green light 45 min NA NA 0.8365 -0.257563 0.0
Light Sensing White light+DCMU 45 min NA NA 0.836532 -0.257507 0.0
Iron Availability -Fe 0 h NA NA None -0.090803 0.922254
Iron Availability -Fe 12 h NA NA None -0.054392 0.724084
Iron Availability -Fe 24 h NA NA None -0.109359 0.486145
Iron Availability -Fe 48 h NA NA None 0.05797 0.478281
Iron Availability -Fe 70 h rescue NA NA None -0.083141 0.269377

Protein Info: PMED4_07111 putative pseudouridylate synthase specific to ribosomal small subunit (rsuA)
COG

Location: 624955 - 625677 (+) on scaffold: NC_005072
Protein Length: 240 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_07111
Alternative Tag: PMM0658
MicrobesOnline ID: VIMSS566007
CyCOG: 3056(ID from pipeline) - 3056 (ID from previou versions)
CyCOG Size: 24
NCBI COG: COG1187

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0655_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_07111 GO:0003723 PF00849 RNA binding 8.7e-15
PMED4_07111 GO:0009982 PF00849 pseudouridine synthase activity 8.7e-15
PMED4_07111 GO:0001522 PF00849 pseudouridine synthesis 8.7e-15
PMED4_07111 GO:0009451 PF00849 RNA modification 8.7e-15

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_07111 PF00849 PseudoU_synth_2 RNA pseudouridylate synthase 8.7e-15
PMED4_07111 PF01479 S4 S4 domain 3.8e-10

Enzyme Information
Protein EC Number Note
PMED4_07111 EC:5.4.99.12 Annotated recently

>PMED4_07111
MATRINKYLSEVGYCSRRVADSLIEEGKVTINGEIPEMGTKVEEGDQVEVEGQRIEKSMKHEKIYLVFNKPVGIVCTTDRRVESDNIIDFIKYPTRIFPI
GRLDKPSEGLIFLTNDGDIVNKILRARNNHEKEYIVSVNRPINRDFIQSMSNGVEILGTITKNCFVKQLGPKKFRIILTQGLNRQIRRMCESLGFRVKSL
KRVRIMNIKLDVSIGEYREFTKEELFELNKLLENSSKTYD

>PMED4_07111
ATGGCAACTAGAATAAATAAATATTTAAGTGAAGTCGGCTACTGCTCTAGAAGAGTAGCAGATAGTCTAATTGAAGAAGGAAAAGTAACTATTAATGGTG
AAATTCCAGAAATGGGTACCAAGGTAGAGGAAGGAGATCAAGTAGAAGTTGAAGGTCAAAGAATTGAAAAATCAATGAAACATGAAAAAATATACTTAGT
TTTTAATAAACCTGTTGGAATTGTTTGCACAACCGATAGAAGAGTAGAATCCGACAATATAATAGATTTTATTAAATATCCCACAAGAATTTTTCCAATT
GGAAGATTGGATAAGCCCAGTGAGGGATTAATTTTCTTAACTAACGATGGCGATATCGTAAATAAAATACTCAGAGCAAGAAATAATCATGAAAAAGAAT
ACATAGTAAGCGTTAATCGACCGATTAATAGAGACTTTATTCAAAGCATGAGTAATGGCGTTGAAATATTAGGTACCATTACTAAGAATTGTTTCGTAAA
ACAATTGGGGCCAAAAAAATTCAGAATCATACTCACTCAAGGACTTAACCGTCAGATTAGGAGAATGTGTGAGTCTTTAGGATTCAGAGTAAAATCATTA
AAGCGTGTAAGAATTATGAATATTAAGTTAGACGTATCAATAGGAGAATATCGCGAATTTACCAAAGAAGAACTCTTTGAATTGAATAAATTACTCGAAA
ACTCTTCAAAAACATATGACTAA