logo
Affymetrix Probeset: MED4_ARR_0689_x_at
Probeset Position: 660841..661104(-)
Number of probes: 11

Microarray Data of MED4_ARR_0689_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 11.54 20.14 0.572989 -0.80342 0.0384
Phosphate Starvation P-depleted 4 h 9.96 8.7 1.14483 0.19513 0.4837
Phosphate Starvation P-depleted 12 h 10.3 10.27 1.00292 0.004208 0.8967
Phosphate Starvation P-depleted 24 h 13.28 13.26 1.00151 0.002174 0.876
Phosphate Starvation P-depleted 48 h 12.36 8.42 1.46793 0.553787 0.119
Nitrogen Availability N deprivation 0 h NA NA 0.684913 -0.546007 0.447332
Nitrogen Availability N deprivation 3 h NA NA 0.773253 -0.370988 0.927826
Nitrogen Availability N deprivation 6 h NA NA 1.75804 0.813971 0.361087
Nitrogen Availability N deprivation 12 h NA NA 1.52207 0.606039 0.443912
Nitrogen Availability N deprivation 24 h NA NA 1.01042 0.014949 0.995548
Nitrogen Availability N deprivation 48 h NA NA 1.2532 0.325612 0.801906
Nitrogen Availability Urea log phase NA NA 1.31581 0.395952 0.874271
Nitrogen Availability Cyanate log phase NA NA 0.907351 -0.140267 0.990024
Light Sensing High light 45 min NA NA 1.4687 0.55454 0.0
Light Sensing White light 45 min NA NA 1.2025 0.266037 0.0
Light Sensing Blue light 45 min NA NA 0.9444 -0.08253 0.0
Light Sensing Red light 45 min NA NA 1.1061 0.145482 0.0
Light Sensing Green light 45 min NA NA 0.8899 -0.168285 0.0
Light Sensing White light+DCMU 45 min NA NA 0.889933 -0.168231 0.0
Iron Availability -Fe 0 h NA NA None 0.0 0.948467
Iron Availability -Fe 12 h NA NA None 0.244887 0.474283
Iron Availability -Fe 24 h NA NA None -0.024737 0.587137
Iron Availability -Fe 48 h NA NA None 0.112367 0.38758
Iron Availability -Fe 70 h rescue NA NA None -0.036526 0.336753

Protein Info: PMED4_07621 possible Hepatitis C virus envelope glycoprote
COG

Location: 660841 - 661104 (-) on scaffold: NC_005072
Protein Length: 87 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_07621
Alternative Tag: PMM0693
MicrobesOnline ID: VIMSS566043
CyCOG: 3107(ID from pipeline) - 3107 (ID from previou versions)
CyCOG Size: 2

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0689_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_07621
MSESKSPLDRIYRLIASHAWMTENEAKVLLVMMYASGTKSLGLEGKGLNKFMERSLEKMCSDNKENLQEYLLKIKDKFPNNELLSED

>PMED4_07621
ATGTCAGAAAGTAAAAGTCCATTAGACAGAATTTATAGATTAATAGCATCGCATGCTTGGATGACTGAGAACGAAGCAAAGGTATTATTAGTAATGATGT
ATGCATCCGGAACAAAGTCTTTAGGATTGGAGGGTAAAGGTTTAAACAAATTTATGGAAAGGTCATTAGAAAAAATGTGTTCCGATAACAAAGAAAACTT
ACAAGAATATCTTTTAAAAATTAAAGATAAATTTCCCAACAATGAATTACTTTCAGAAGATTAA