logo
Affymetrix Probeset: MED4_ARR_0698_x_at
Probeset Position: 666574..666960(+)
Number of probes: 11

Microarray Data of MED4_ARR_0698_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 36.17 43.79 0.825988 -0.275808 0.3983
Phosphate Starvation P-depleted 4 h 28.61 31.99 0.894342 -0.161101 0.5411
Phosphate Starvation P-depleted 12 h 36.02 38.35 0.939244 -0.090428 0.8584
Phosphate Starvation P-depleted 24 h 40.87 39.14 1.0442 0.062399 0.854
Phosphate Starvation P-depleted 48 h 32.99 29.08 1.13446 0.182002 0.197
Nitrogen Availability N deprivation 0 h NA NA 0.870981 -0.199287 0.683814
Nitrogen Availability N deprivation 3 h NA NA 0.617716 -0.694985 0.767055
Nitrogen Availability N deprivation 6 h NA NA 0.735042 -0.444101 0.624462
Nitrogen Availability N deprivation 12 h NA NA 1.6016 0.679509 0.315631
Nitrogen Availability N deprivation 24 h NA NA 1.04439 0.06266 0.975863
Nitrogen Availability N deprivation 48 h NA NA 1.49987 0.584838 0.544273
Nitrogen Availability Urea log phase NA NA 1.02055 0.02934 0.987328
Nitrogen Availability Cyanate log phase NA NA 0.959712 -0.059326 0.990024
Light Sensing High light 45 min NA NA 1.4641 0.550014 0.0
Light Sensing White light 45 min NA NA 1.2322 0.301236 0.0
Light Sensing Blue light 45 min NA NA 1.0526 0.073957 0.0
Light Sensing Red light 45 min NA NA 1.0967 0.133169 0.0
Light Sensing Green light 45 min NA NA 0.8876 -0.172018 0.0
Light Sensing White light+DCMU 45 min NA NA 0.887609 -0.172004 0.0
Iron Availability -Fe 0 h NA NA None -0.136062 0.905779
Iron Availability -Fe 12 h NA NA None 0.750178 0.005039
Iron Availability -Fe 24 h NA NA None 0.678973 0.001264
Iron Availability -Fe 48 h NA NA None 1.115699 2.9e-05
Iron Availability -Fe 70 h rescue NA NA None -1.187707 7e-06

Protein Info: PMED4_07741 possible DUP family
COG

Location: 666574 - 666960 (+) on scaffold: NC_005072
Protein Length: 128 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_07741
Alternative Tag: PMM0702
MicrobesOnline ID: VIMSS566052
CyCOG: 3119(ID from pipeline) - 3119 (ID from previou versions)
CyCOG Size: 11

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0698_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_07741
MNRKSNNSNPTGNLDYDKILEEEIINSYENKFEANSNINNKNKRFYRLKRTPLEVINRLFFFFFVGSFIFSFFLAYSENKVWFIIYLISAFSCIFYTPNR
KALKELIAAWPNIEDLIKGRSLWRKDNK

>PMED4_07741
ATGAATAGAAAGTCAAATAATTCTAATCCAACTGGAAATCTAGATTATGACAAGATTCTTGAGGAGGAAATAATTAATTCTTATGAAAATAAGTTTGAAG
CTAATTCTAATATCAATAATAAAAACAAAAGATTTTACAGACTTAAAAGAACGCCTCTTGAAGTAATAAATAGATTATTTTTCTTTTTCTTTGTTGGAAG
TTTTATATTCTCATTCTTTTTAGCTTATTCAGAAAATAAAGTCTGGTTCATTATTTATTTAATTAGTGCATTCTCATGTATTTTTTATACTCCAAATAGA
AAAGCCCTTAAGGAATTAATAGCAGCCTGGCCTAACATTGAAGATCTTATTAAAGGAAGAAGCTTGTGGAGGAAGGATAATAAATAA