logo
Affymetrix Probeset: MED4_ARR_0730_x_at
Probeset Position: 697920..698285(-)
Number of probes: 10

Microarray Data of MED4_ARR_0730_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 27.64 46.1 0.599566 -0.738009 0.0489
Phosphate Starvation P-depleted 4 h 41.86 41.95 0.997855 -0.003099 0.6772
Phosphate Starvation P-depleted 12 h 49.56 48.7 1.01766 0.025254 0.8901
Phosphate Starvation P-depleted 24 h 62.87 70.62 0.890258 -0.167705 0.763
Phosphate Starvation P-depleted 48 h 56.9 37.64 1.51169 0.596162 0.128
Nitrogen Availability N deprivation 0 h NA NA 0.980457 -0.028474 0.946384
Nitrogen Availability N deprivation 3 h NA NA 1.29784 0.376114 0.854685
Nitrogen Availability N deprivation 6 h NA NA 1.67504 0.744199 0.150943
Nitrogen Availability N deprivation 12 h NA NA 1.31917 0.399629 0.526482
Nitrogen Availability N deprivation 24 h NA NA 1.27132 0.346326 0.864681
Nitrogen Availability N deprivation 48 h NA NA 0.752214 -0.410784 0.680389
Nitrogen Availability Urea log phase NA NA 1.10136 0.139292 0.913442
Nitrogen Availability Cyanate log phase NA NA 0.89721 -0.156482 0.978192
Light Sensing High light 45 min NA NA 0.8067 -0.309896 0.0
Light Sensing White light 45 min NA NA 1.2783 0.354226 0.0
Light Sensing Blue light 45 min NA NA 0.8003 -0.321387 0.0
Light Sensing Red light 45 min NA NA 1.0263 0.037452 0.0
Light Sensing Green light 45 min NA NA 0.8576 -0.221623 0.0
Light Sensing White light+DCMU 45 min NA NA 0.857632 -0.221569 0.0
Iron Availability -Fe 0 h NA NA None -0.26708 0.755013
Iron Availability -Fe 12 h NA NA None 0.176323 0.368703
Iron Availability -Fe 24 h NA NA None -0.02327 0.568046
Iron Availability -Fe 48 h NA NA None 0.107018 0.273792
Iron Availability -Fe 70 h rescue NA NA None -0.239566 0.020945

Protein Info: PMED4_08111 possible Helix-turn-helix protein, copG family
COG

Location: 697920 - 698285 (-) on scaffold: NC_005072
Protein Length: 121 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_08111
Alternative Tag: PMM0734
MicrobesOnline ID: VIMSS566084
CyCOG: 3156(ID from pipeline) - 3156 (ID from previou versions)
CyCOG Size: 9

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0730_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_08111
MENPVKRIGYLPRKRVLEIIDQISKSESISRSKVVGILVEEALDSRGIANFGYGNLSKTKSFNSETYTNNQPIKNISDSEDEFVDDSGYTISSQKTSDRS
ISTADIELANKINFLKESGLI

>PMED4_08111
ATGGAAAATCCAGTTAAAAGGATAGGGTATTTACCCAGGAAAAGAGTTCTGGAAATTATAGATCAAATATCTAAAAGTGAATCTATAAGCAGGTCAAAAG
TTGTTGGAATACTAGTAGAAGAAGCATTGGATTCTAGAGGTATCGCAAATTTTGGATATGGCAATTTGAGTAAAACTAAATCATTTAATTCTGAAACTTA
TACCAATAATCAACCCATTAAAAATATATCCGATTCAGAGGATGAGTTTGTTGATGATAGCGGATATACAATCTCTTCCCAAAAAACTTCAGATAGATCT
ATCTCAACAGCAGATATTGAACTAGCAAATAAAATCAATTTCTTAAAAGAATCAGGTTTAATTTAG