logo
Affymetrix Probeset: MED4_ARR_0800_x_at
Probeset Position: 763548..763838(-)
Number of probes: 10

Microarray Data of MED4_ARR_0800_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 5.45 5.23 1.04207 0.059445 0.6281
Phosphate Starvation P-depleted 4 h 8.45 5.61 1.50624 0.590951 0.3436
Phosphate Starvation P-depleted 12 h 7.31 7.04 1.03835 0.054296 0.7812
Phosphate Starvation P-depleted 24 h 10.78 8.19 1.31624 0.396422 0.634
Phosphate Starvation P-depleted 48 h 33.66 5.9 5.70508 2.51225 0.00358
Nitrogen Availability N deprivation 0 h NA NA 0.852145 -0.230829 0.778621
Nitrogen Availability N deprivation 3 h NA NA 0.663598 -0.591618 0.866325
Nitrogen Availability N deprivation 6 h NA NA 1.35398 0.437204 0.649123
Nitrogen Availability N deprivation 12 h NA NA 0.77774 -0.362639 0.696669
Nitrogen Availability N deprivation 24 h NA NA 0.445768 -1.16564 0.859843
Nitrogen Availability N deprivation 48 h NA NA 1.40048 0.485926 0.681143
Nitrogen Availability Urea log phase NA NA 1.02537 0.036144 0.98824
Nitrogen Availability Cyanate log phase NA NA 1.22891 0.297375 0.978568
Light Sensing High light 45 min NA NA 0.7758 -0.366243 0.0
Light Sensing White light 45 min NA NA 0.95 -0.074001 0.0
Light Sensing Blue light 45 min NA NA 0.6071 -0.719994 0.0
Light Sensing Red light 45 min NA NA 0.896 -0.158429 0.0
Light Sensing Green light 45 min NA NA 0.9946 -0.007812 0.0
Light Sensing White light+DCMU 45 min NA NA 0.994587 -0.007831 0.0
Iron Availability -Fe 0 h NA NA None 0.092207 0.930462
Iron Availability -Fe 12 h NA NA None 1.735089 0.000369
Iron Availability -Fe 24 h NA NA None 1.801986 2.4e-05
Iron Availability -Fe 48 h NA NA None 2.006118 3e-06
Iron Availability -Fe 70 h rescue NA NA None -3.662004 0.0

Protein Info: PMED4_08911 hypothetical
COG

Location: 763548 - 763838 (-) on scaffold: NC_005072
Protein Length: 96 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_08911
Alternative Tag: PMM0805
MicrobesOnline ID: VIMSS566155
CyCOG: 3236(ID from pipeline) - 3236 (ID from previou versions)
CyCOG Size: 10

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0800_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_08911
MYKSESIINNLLIEVDSLSYRITNIHQAYFNTSHVGLRDRLFYENKNISQRLNEIFSIAKVLKNRNNENISFSSLLVEKCKRTIDQKRIEKNLFFL

>PMED4_08911
ATGTATAAATCTGAATCCATAATCAATAACTTGCTAATAGAAGTTGACTCATTAAGTTACAGGATAACGAATATTCATCAAGCTTATTTCAACACTTCAC
ACGTAGGATTGCGAGATAGATTATTTTATGAAAATAAAAATATCTCGCAAAGATTAAATGAGATATTTTCAATAGCAAAAGTATTAAAAAATAGAAATAA
TGAAAATATTAGTTTTTCTAGTTTATTAGTTGAGAAATGTAAAAGAACTATTGATCAAAAAAGAATAGAAAAGAATTTATTTTTTCTTTAA