logo
Affymetrix Probeset: MED4_ARR_0812_x_at
Probeset Position: 773484..773693(-)
Number of probes: 10

Microarray Data of MED4_ARR_0812_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 11430.3 13707.0 0.833905 -0.262046 0.2793
Phosphate Starvation P-depleted 4 h 5453.0 5472.5 0.996437 -0.00515 0.6615
Phosphate Starvation P-depleted 12 h 3240.0 3276.33 0.988911 -0.016087 0.8967
Phosphate Starvation P-depleted 24 h 2771.67 2871.0 0.965402 -0.050798 0.85
Phosphate Starvation P-depleted 48 h 3693.5 3030.5 1.21878 0.285433 0.132
Nitrogen Availability N deprivation 0 h NA NA 0.571629 -0.80685 0.08446
Nitrogen Availability N deprivation 3 h NA NA 1.67145 0.741099 0.758715
Nitrogen Availability N deprivation 6 h NA NA 1.50771 0.592357 0.603865
Nitrogen Availability N deprivation 12 h NA NA 0.80896 -0.305859 0.511841
Nitrogen Availability N deprivation 24 h NA NA 1.73924 0.798458 0.392523
Nitrogen Availability N deprivation 48 h NA NA 5.3914 2.43066 0.0
Nitrogen Availability Urea log phase NA NA 1.82224 0.865716 0.0
Nitrogen Availability Cyanate log phase NA NA 2.41629 1.2728 0.0
Light Sensing High light 45 min NA NA 33.0537 5.04674 0.0
Light Sensing White light 45 min NA NA 6.3158 2.65897 0.0
Light Sensing Blue light 45 min NA NA 15.03 3.90977 0.0
Light Sensing Red light 45 min NA NA 2.7652 1.46738 0.0
Light Sensing Green light 45 min NA NA 0.5302 -0.915391 0.0
Light Sensing White light+DCMU 45 min NA NA 0.530184 -0.915436 0.0
Iron Availability -Fe 0 h NA NA None 0.306845 0.73674
Iron Availability -Fe 12 h NA NA None 0.707525 0.022449
Iron Availability -Fe 24 h NA NA None 0.948601 6.8e-05
Iron Availability -Fe 48 h NA NA None 1.231432 2.1e-05
Iron Availability -Fe 70 h rescue NA NA None -1.286304 2e-06

Protein Info: PMED4_09091 possible high light inducible protein (hli17)
COG

Location: 773484 - 773693 (-) on scaffold: NC_005072
Protein Length: 69 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_09091
Alternative Tag: PMM0817
MicrobesOnline ID: VIMSS566167
CyCOGOrphan: 0(ID from pipeline) - None (ID from previou versions)
CyCOGOrphan Size: 8908

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0812_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_09091
MSNSSYTTTESGGRQNMFPSETRPYIDESVSYDGYPQNAEKVNGRWAMIGFVALLGAYVTTGQIIPGIF

>PMED4_09091
ATGTCAAATTCTTCATACACAACAACTGAGTCTGGCGGAAGACAAAACATGTTTCCATCAGAAACTCGTCCTTACATAGATGAGTCAGTTTCTTATGACG
GCTATCCTCAAAACGCAGAAAAAGTTAACGGTCGTTGGGCAATGATTGGCTTCGTAGCATTATTAGGTGCATACGTAACAACAGGTCAAATCATTCCAGG
TATTTTTTAA