logo
Affymetrix Probeset: MED4_ARR_0813_s_at
Probeset Position: 773693..773836(-)
Number of probes: 11

Microarray Data of MED4_ARR_0813_s_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 9149.67 12070.5 0.758019 -0.399694 0.0919
Phosphate Starvation P-depleted 4 h 4057.5 4135.5 0.981139 -0.027471 0.6484
Phosphate Starvation P-depleted 12 h 2420.33 2281.0 1.06108 0.085537 0.7662
Phosphate Starvation P-depleted 24 h 2659.0 3021.33 0.880076 -0.1843 0.643
Phosphate Starvation P-depleted 48 h 2641.5 2277.0 1.16008 0.214223 0.16
Nitrogen Availability N deprivation 0 h NA NA 0.583368 -0.777521 0.075812
Nitrogen Availability N deprivation 3 h NA NA 1.51306 0.597474 0.813468
Nitrogen Availability N deprivation 6 h NA NA 1.74255 0.801202 0.460503
Nitrogen Availability N deprivation 12 h NA NA 0.93424 -0.098135 0.822589
Nitrogen Availability N deprivation 24 h NA NA 2.03793 1.02711 0.114754
Nitrogen Availability N deprivation 48 h NA NA 6.9162 2.78998 0.0
Nitrogen Availability Urea log phase NA NA 1.67822 0.746933 0.035714
Nitrogen Availability Cyanate log phase NA NA 2.5659 1.35947 0.0
Light Sensing High light 45 min NA NA 41.6679 5.38086 0.0
Light Sensing White light 45 min NA NA 6.645 2.73227 0.0
Light Sensing Blue light 45 min NA NA 16.3556 4.03171 0.0
Light Sensing Red light 45 min NA NA 2.9071 1.53958 0.0
Light Sensing Green light 45 min NA NA 0.4956 -1.01275 0.0
Light Sensing White light+DCMU 45 min NA NA 0.495649 -1.01261 0.0
Iron Availability -Fe 0 h NA NA None 0.16092 0.90837
Iron Availability -Fe 12 h NA NA None 0.682573 0.011686
Iron Availability -Fe 24 h NA NA None 0.90458 6.3e-05
Iron Availability -Fe 48 h NA NA None 1.062812 3.2e-05
Iron Availability -Fe 70 h rescue NA NA None -1.231075 2e-06

Protein Info: PMED4_09101 possible high light inducible protein (hli16)
COG

Location: 773693 - 773800 (-) on scaffold: NC_005072
Protein Length: 35 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_09101
Alternative Tag: PMM0818
MicrobesOnline ID: VIMSS566168
CyCOGOrphan: 0(ID from pipeline) - None (ID from previou versions)
CyCOGOrphan Size: 8908

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0813_s_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_09101
MTPDAERFNGLAAMLGFVAAVGAYVTTGQIIPGFF

>PMED4_09101
ATGACACCTGACGCAGAAAGATTTAACGGCTTAGCAGCAATGCTTGGTTTCGTAGCAGCTGTTGGCGCATACGTAACAACTGGTCAAATAATTCCTGGTT
TTTTCTAA