logo
Affymetrix Probeset: MED4_ARR_0953_x_at
Probeset Position: 916287..916514(-)
Number of probes: 10

Microarray Data of MED4_ARR_0953_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 48.15 88.01 0.547097 -0.870132 0.0489
Phosphate Starvation P-depleted 4 h 48.63 80.33 0.605378 -0.724092 0.2694
Phosphate Starvation P-depleted 12 h 66.16 101.11 0.654337 -0.611895 0.3722
Phosphate Starvation P-depleted 24 h 65.83 82.38 0.799102 -0.323549 0.634
Phosphate Starvation P-depleted 48 h 43.25 48.24 0.896559 -0.15753 0.246
Nitrogen Availability N deprivation 0 h NA NA 0.704655 -0.505011 0.55162
Nitrogen Availability N deprivation 3 h NA NA 28.2534 4.82035 0.0
Nitrogen Availability N deprivation 6 h NA NA 64.8316 6.01862 0.0
Nitrogen Availability N deprivation 12 h NA NA 25.1557 4.65281 0.0
Nitrogen Availability N deprivation 24 h NA NA 11.5254 3.52674 0.0
Nitrogen Availability N deprivation 48 h NA NA 16.1012 4.0091 0.0
Nitrogen Availability Urea log phase NA NA 0.659245 -0.601113 0.820291
Nitrogen Availability Cyanate log phase NA NA 1.69678 0.762798 0.953996
Light Sensing High light 45 min NA NA 0.7764 -0.365128 0.0
Light Sensing White light 45 min NA NA 0.7835 -0.351995 0.0
Light Sensing Blue light 45 min NA NA 1.1156 0.15782 0.0
Light Sensing Red light 45 min NA NA 0.9781 -0.031946 0.0
Light Sensing Green light 45 min NA NA 0.819 -0.288065 0.0
Light Sensing White light+DCMU 45 min NA NA 0.818981 -0.288097 0.0
Iron Availability -Fe 0 h NA NA None -0.02327 0.946127
Iron Availability -Fe 12 h NA NA None 0.264236 0.31762
Iron Availability -Fe 24 h NA NA None 0.876566 0.001106
Iron Availability -Fe 48 h NA NA None 1.141433 8.9e-05
Iron Availability -Fe 70 h rescue NA NA None -1.029146 6.9e-05

Protein Info: PMED4_10701 conserved hypothetical
COG

Location: 916287 - 916514 (-) on scaffold: NC_005072
Protein Length: 75 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_10701
Alternative Tag: PMM0958
MicrobesOnline ID: VIMSS566313
CyCOG: 3415(ID from pipeline) - 3415 (ID from previou versions)
CyCOG Size: 21

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_0953_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_10701 PF08865 DUF1830 Domain of unknown function (DUF1830) 5.3e-29

Enzyme Information
Protein EC Number Note
None None None

>PMED4_10701
MVEFSYKNEGSRMVVLRCIGPSNFFLERVLFPTDILSFTAPNDSRVEIWGNELYGPKLEERIRISSENEDATLVA

>PMED4_10701
ATGGTTGAGTTTTCTTATAAAAATGAAGGCTCCAGAATGGTCGTTTTGAGATGTATAGGTCCTTCTAACTTTTTTTTAGAAAGAGTGCTATTTCCGACGG
ATATTTTATCTTTTACGGCTCCTAACGATTCTAGAGTTGAAATTTGGGGTAATGAATTATATGGTCCTAAACTAGAAGAAAGGATAAGAATTTCTTCTGA
AAATGAAGATGCAACTCTAGTTGCCTAA