logo
Affymetrix Probeset: MED4_ARR_1027_x_at
Probeset Position: 975567..976988(+)
Number of probes: 17

Microarray Data of MED4_ARR_1027_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 27.09 30.2 0.89702 -0.156788 0.5183
Phosphate Starvation P-depleted 4 h 44.17 30.43 1.45153 0.537573 0.3691
Phosphate Starvation P-depleted 12 h 28.1 31.97 0.878949 -0.186149 0.6403
Phosphate Starvation P-depleted 24 h 38.53 44.67 0.862548 -0.213324 0.737
Phosphate Starvation P-depleted 48 h 36.19 35.56 1.01772 0.025336 0.277
Nitrogen Availability N deprivation 0 h NA NA 0.509392 -0.973152 0.309981
Nitrogen Availability N deprivation 3 h NA NA 0.912788 -0.131648 0.97411
Nitrogen Availability N deprivation 6 h NA NA 0.790074 -0.33994 0.771329
Nitrogen Availability N deprivation 12 h NA NA 1.60086 0.678845 0.433087
Nitrogen Availability N deprivation 24 h NA NA 1.79189 0.841483 0.569418
Nitrogen Availability N deprivation 48 h NA NA 2.53837 1.3439 0.14321
Nitrogen Availability Urea log phase NA NA 1.06142 0.085995 0.985018
Nitrogen Availability Cyanate log phase NA NA 1.17506 0.232731 0.985274
Light Sensing High light 45 min NA NA 1.4648 0.550704 0.0
Light Sensing White light 45 min NA NA 1.1837 0.243303 0.0
Light Sensing Blue light 45 min NA NA 1.1419 0.191436 0.0
Light Sensing Red light 45 min NA NA 1.272 0.347099 0.0
Light Sensing Green light 45 min NA NA 0.8505 -0.233617 0.0
Light Sensing White light+DCMU 45 min NA NA 0.850495 -0.233625 0.0
Iron Availability -Fe 0 h NA NA None -0.155213 0.901777
Iron Availability -Fe 12 h NA NA None 0.687061 0.009199
Iron Availability -Fe 24 h NA NA None 0.950842 0.000216
Iron Availability -Fe 48 h NA NA None 0.85997 0.000279
Iron Availability -Fe 70 h rescue NA NA None -1.878321 0.0

Protein Info: PMED4_11751 ABC transporter, substrate binding protein, possibly Mn. (lraI)
COG

Location: 975567 - 976988 (+) on scaffold: NC_005072
Protein Length: 473 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_11751
Alternative Tag: PMM1032
MicrobesOnline ID: VIMSS566387
CyCOG: 3520(ID from pipeline) - 3520 (ID from previou versions)
CyCOG Size: 9
NCBI COG: COG803

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1027_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
PMED4_11751 GO:0046872 PF01297 metal ion binding 0.0
PMED4_11751 GO:0030001 PF01297 metal ion transport 0.0

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_11751 PF01297 SBP_bac_9 Periplasmic solute binding protein family 0.0

Enzyme Information
Protein EC Number Note
None None None

>PMED4_11751
MSIFKKVIFSNKRSNHSVIKNSLLAGTVLLSTVAQDVLAKEKSYVAVEPLTCDLVKSIALPSDEVTCLVDRKQDVHDFKITPRQAQLLKSADKVFTLGKE
MTPSMKNWEGKPQTVVIGVSAIDIDDHSGHDDHAEGSFEWAGKFQLSKGSYKWSFAKVGGEYADPAMKMVILESNDIESSEKLAKELLGSKKSINKKNNG
TLVASNKAYVLNFDQGKESTVFNVEIQEDGQYTFFTEHMPFEFEAEEHFFKDLSNSDVEPIAQVPDEGEGNHHHDHGGLDPHVWHDPHNIKKMGEVVSKS
LKKDISVFNRSDRKSINASFASVDSTLEELDSWIVAQVSTIPESNRVIVSKHKAMEYYGNAFGFETISLLDFIGDSSSLRPDNIQSTLKMLDEENVKAIF
PEQIPASKLLKNLSRQSSVPLASNQIFVDGLMMTGNTVSVAVHNTCTIVNSLGGTCDKEAGSSIEGNWISLQN

>PMED4_11751
ATGTCAATTTTTAAAAAAGTAATCTTTAGTAATAAGAGATCTAATCATTCTGTTATCAAAAACTCTTTATTAGCTGGAACCGTATTATTATCAACAGTTG
CTCAAGATGTTTTAGCGAAAGAAAAATCATATGTAGCTGTAGAGCCACTCACTTGCGATTTAGTAAAATCTATTGCCTTACCTTCTGATGAAGTAACTTG
TTTGGTTGATAGAAAACAAGATGTACATGACTTTAAAATAACTCCAAGACAAGCTCAATTACTTAAAAGTGCGGATAAAGTTTTTACTCTAGGGAAAGAG
ATGACCCCAAGCATGAAAAATTGGGAGGGTAAGCCTCAAACAGTTGTAATTGGTGTAAGTGCTATAGATATAGATGATCACTCTGGGCATGATGACCATG
CAGAAGGTTCATTTGAATGGGCAGGCAAATTTCAACTCTCTAAAGGTTCCTACAAATGGTCATTCGCAAAGGTAGGAGGGGAATATGCAGATCCAGCTAT
GAAAATGGTGATTCTCGAATCAAATGATATTGAATCTTCTGAAAAACTTGCTAAAGAACTATTAGGTTCTAAGAAGTCAATAAATAAAAAAAATAATGGG
ACTCTTGTAGCTAGTAATAAAGCCTATGTTCTTAATTTTGATCAAGGGAAGGAGAGTACAGTATTTAATGTAGAAATTCAAGAAGATGGCCAATATACAT
TCTTCACTGAACATATGCCTTTTGAGTTTGAAGCCGAAGAACACTTCTTTAAAGATTTATCTAATAGCGATGTTGAACCAATTGCACAAGTTCCAGATGA
AGGCGAGGGAAATCATCACCATGATCACGGAGGATTAGATCCACATGTTTGGCATGATCCTCATAACATCAAAAAGATGGGAGAAGTTGTAAGTAAAAGT
TTAAAGAAAGATATCTCTGTTTTTAATAGATCTGACAGGAAATCAATCAATGCGAGCTTTGCTTCAGTAGATTCAACACTAGAAGAACTTGATAGCTGGA
TTGTTGCACAGGTCTCAACAATTCCAGAATCCAACAGAGTTATTGTATCTAAACATAAAGCAATGGAATATTACGGCAATGCTTTTGGATTTGAGACTAT
TAGCTTACTAGATTTTATTGGTGACTCATCAAGTTTAAGACCTGACAATATTCAATCAACGTTGAAGATGCTTGATGAAGAAAATGTTAAGGCAATATTT
CCTGAACAAATACCAGCTTCTAAGTTATTAAAAAACTTGAGTAGACAAAGTTCAGTTCCTTTAGCTTCTAATCAAATATTTGTTGATGGATTAATGATGA
CAGGGAATACAGTTTCTGTTGCTGTTCACAATACATGTACCATTGTTAATTCATTAGGTGGAACATGTGATAAGGAAGCAGGCTCCAGCATTGAAGGCAA
CTGGATTTCTCTACAAAATTAA