logo
Affymetrix Probeset: MED4_ARR_1221_x_at
Probeset Position: 1179882..1181048(+)
Number of probes: 14

Microarray Data of MED4_ARR_1221_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 14.76 15.33 0.962818 -0.054665 0.6583
Phosphate Starvation P-depleted 4 h 21.56 26.12 0.825421 -0.276798 0.4371
Phosphate Starvation P-depleted 12 h 24.45 21.55 1.13457 0.182147 0.6834
Phosphate Starvation P-depleted 24 h 23.62 25.05 0.942914 -0.084802 0.85
Phosphate Starvation P-depleted 48 h 27.84 23.63 1.17816 0.23654 0.207
Nitrogen Availability N deprivation 0 h NA NA 0.916998 -0.125009 0.803815
Nitrogen Availability N deprivation 3 h NA NA 0.81788 -0.290039 0.914291
Nitrogen Availability N deprivation 6 h NA NA 0.63702 -0.65059 0.459824
Nitrogen Availability N deprivation 12 h NA NA 0.503526 -0.989863 0.272727
Nitrogen Availability N deprivation 24 h NA NA 0.052863 -4.24159 0.215517
Nitrogen Availability N deprivation 48 h NA NA 0.298997 -1.7418 0.280845
Nitrogen Availability Urea log phase NA NA 1.22006 0.286948 0.872925
Nitrogen Availability Cyanate log phase NA NA 1.00758 0.010894 0.998044
Light Sensing High light 45 min NA NA 1.0697 0.097206 0.0
Light Sensing White light 45 min NA NA 1.6077 0.684998 0.0
Light Sensing Blue light 45 min NA NA 1.1697 0.226139 0.0
Light Sensing Red light 45 min NA NA 1.3197 0.40021 0.0
Light Sensing Green light 45 min NA NA 0.8362 -0.25808 0.0
Light Sensing White light+DCMU 45 min NA NA 0.836176 -0.258122 0.0
Iron Availability -Fe 0 h NA NA None -0.258425 0.828413
Iron Availability -Fe 12 h NA NA None -0.469929 0.051632
Iron Availability -Fe 24 h NA NA None -0.42082 0.047133
Iron Availability -Fe 48 h NA NA None -0.261881 0.131398
Iron Availability -Fe 70 h rescue NA NA None 0.689746 0.00016

Protein Info: PMED4_13931 hypothetical protein
COG

Location: 1179882 - 1181048 (+) on scaffold: NC_005072
Protein Length: 388 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_13931
Alternative Tag: PMM1228
MicrobesOnline ID: VIMSS566588
CyCOGOrphan: 0(ID from pipeline) - None (ID from previou versions)
CyCOGOrphan Size: 8908

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1221_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_13931
MVIPKFGFLERPDIDLLKSFKIKKYLSGWKYYLGRYKYPNFTGNLINYVIGPILKNKFVFLRCDCDHFGPWTYLFLFTKSQLFKKDKIYFCLARKNTINR
HWINLYRKKNLILIFNPILHFILSPLFFAPIIALDVNAHNYISFFRNNIKYKHFRRMNELSDDFLASINNDKSLPKRNESIFNNKIVLLYARTGNWRFSI
KNSTRNMSLEASNELIRIISKSYNVFLVGDTQFSNKSKNKNIFDESYLLKNNISISEIYKRASFVIGSCSGGTHFPSLIFNIPTLYIADIPLWHLKAIYN
LPASNYKNLSIPKKDKWLLISKEKFNSLTSNQYEDILQIFFKGGDISSIKEFNTYRCDRSFNKEEPAFTKDKKGNIHISEFSYNTLGI

>PMED4_13931
ATGGTAATTCCAAAGTTTGGTTTTCTTGAGAGACCTGATATTGATTTATTGAAGTCTTTTAAAATAAAAAAATATTTATCTGGATGGAAATATTATTTAG
GTCGATATAAATATCCAAATTTTACAGGTAATTTGATAAATTATGTTATTGGACCAATATTAAAAAATAAATTTGTTTTTTTAAGGTGTGATTGTGATCA
TTTTGGACCGTGGACATACTTATTTCTGTTTACAAAATCTCAACTATTTAAAAAAGATAAAATTTATTTTTGTTTAGCTAGAAAAAATACTATTAATAGG
CATTGGATTAATTTATACAGAAAAAAAAATCTTATTTTAATTTTTAATCCTATATTACATTTTATTTTATCACCCTTATTTTTTGCTCCTATTATTGCAT
TAGATGTTAACGCTCATAACTATATTTCATTTTTTAGAAATAATATCAAATATAAGCATTTCAGAAGAATGAATGAATTGAGTGACGATTTTTTAGCATC
AATAAACAATGATAAGTCATTACCTAAAAGAAATGAATCAATATTTAATAATAAAATTGTATTACTCTATGCGAGAACAGGAAATTGGAGATTTTCAATA
AAAAATTCAACTAGAAATATGTCCCTAGAGGCATCGAACGAATTAATTAGAATTATTAGCAAAAGTTATAACGTTTTTTTAGTAGGTGATACACAATTCT
CAAATAAATCTAAAAATAAAAATATTTTTGATGAATCATATCTTTTAAAAAATAATATATCAATATCAGAAATATATAAAAGGGCTTCATTTGTTATTGG
GAGTTGTTCAGGGGGTACTCATTTCCCTTCACTTATTTTTAATATTCCCACTTTATATATAGCTGATATACCTTTATGGCACTTGAAAGCTATTTACAAC
CTCCCAGCATCTAATTATAAAAATTTATCAATTCCTAAGAAAGATAAGTGGTTACTTATCTCGAAAGAAAAATTTAATTCACTAACTTCTAATCAATATG
AAGATATTTTACAAATATTTTTCAAGGGGGGGGATATTTCATCTATTAAAGAATTCAATACTTACAGATGTGATAGATCCTTTAATAAAGAGGAACCAGC
ATTTACTAAGGATAAGAAAGGAAATATACATATTTCAGAATTCAGTTATAACACTTTGGGTATTTAA