logo
Affymetrix Probeset: MED4_ARR_1350_x_at
Probeset Position: 1307800..1308360(-)
Number of probes: 10

Microarray Data of MED4_ARR_1350_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 2096.67 1296.95 1.61662 0.692977 0.022
Phosphate Starvation P-depleted 4 h 618.6 505.25 1.22434 0.292009 0.394
Phosphate Starvation P-depleted 12 h 286.47 159.1 1.80057 0.84845 0.0538
Phosphate Starvation P-depleted 24 h 192.07 215.23 0.892394 -0.164247 0.781
Phosphate Starvation P-depleted 48 h 227.35 136.71 1.66301 0.733796 0.114
Nitrogen Availability N deprivation 0 h NA NA 0.833198 -0.263268 0.548288
Nitrogen Availability N deprivation 3 h NA NA 2.03833 1.02738 0.725
Nitrogen Availability N deprivation 6 h NA NA 1.23552 0.305119 0.654545
Nitrogen Availability N deprivation 12 h NA NA 0.661075 -0.597115 0.319149
Nitrogen Availability N deprivation 24 h NA NA 1.1625 0.217234 0.891328
Nitrogen Availability N deprivation 48 h NA NA 1.65095 0.7233 0.441129
Nitrogen Availability Urea log phase NA NA 0.973564 -0.038653 0.982481
Nitrogen Availability Cyanate log phase NA NA 1.16619 0.221806 0.953996
Light Sensing High light 45 min NA NA 61.1657 5.93465 0.0
Light Sensing White light 45 min NA NA 17.4225 4.12288 0.0
Light Sensing Blue light 45 min NA NA 37.1759 5.2163 0.0
Light Sensing Red light 45 min NA NA 5.9056 2.56208 0.0
Light Sensing Green light 45 min NA NA 0.2387 -2.06673 0.0
Light Sensing White light+DCMU 45 min NA NA 0.238658 -2.06699 0.0
Iron Availability -Fe 0 h NA NA None 0.238787 0.802552
Iron Availability -Fe 12 h NA NA None 0.475085 0.053885
Iron Availability -Fe 24 h NA NA None 0.452068 0.012968
Iron Availability -Fe 48 h NA NA None 0.489543 0.005337
Iron Availability -Fe 70 h rescue NA NA None -0.254978 0.019807

Protein Info: PMED4_15281 Predicted membrane protein
COG

Location: 1307800 - 1308360 (-) on scaffold: NC_005072
Protein Length: 186 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15281
Alternative Tag: PMM1359
MicrobesOnline ID: VIMSS566725
CyCOG: 3873(ID from pipeline) - 3873 (ID from previou versions)
CyCOG Size: 19
NCBI COG: COG2259

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1350_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
PMED4_15281 PF07681 DoxX DoxX 9.3e-21

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15281
MLSTILTKSFSKDTALLILRVITGTVLIHHGFEKLANIDNFADAFVRPLHLPFPIFLSYVAAFSEIGGSWLLILGLATRFGALAIVGTISVAIYHALVTS
GFNIFLLELLLLYFASATSIALTGPGDFSIDEVIIRVLRSESAEEDIQETVKTKANNGKSISQEDSTNKGGIFQFLQANLLSDTSN

>PMED4_15281
GTGCTTTCAACAATTCTTACAAAATCATTCAGCAAAGATACAGCTTTATTAATCTTAAGAGTAATTACTGGTACAGTTTTAATTCATCATGGATTTGAAA
AGCTAGCTAATATAGATAATTTTGCTGATGCTTTTGTCAGACCCTTACACTTACCTTTCCCAATATTTTTATCATATGTAGCTGCATTTTCAGAAATTGG
TGGAAGCTGGTTATTAATACTTGGTTTAGCTACAAGATTTGGTGCATTAGCAATAGTTGGTACTATATCGGTTGCTATCTATCATGCTCTAGTAACATCG
GGATTTAATATTTTCTTGTTAGAACTTTTACTACTTTATTTCGCCTCAGCTACCTCAATAGCACTAACAGGTCCTGGAGATTTCTCAATTGATGAAGTAA
TAATAAGAGTATTGAGATCTGAATCTGCTGAAGAAGATATTCAAGAAACAGTAAAAACTAAAGCAAATAATGGTAAATCAATCAGTCAAGAGGATTCAAC
TAATAAAGGTGGTATCTTCCAATTCCTACAAGCTAACCTACTCTCAGATACTTCAAATTAA