logo
Affymetrix Probeset: MED4_ARR_1356_x_at
Probeset Position: 1313124..1313438(+)
Number of probes: 10

Microarray Data of MED4_ARR_1356_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 729.73 1307.5 0.558111 -0.841376 0.021
Phosphate Starvation P-depleted 4 h 355.25 303.4 1.1709 0.227614 0.5457
Phosphate Starvation P-depleted 12 h 617.6 546.2 1.13072 0.177243 0.6606
Phosphate Starvation P-depleted 24 h 785.5 723.27 1.08604 0.119077 0.778
Phosphate Starvation P-depleted 48 h 479.4 377.45 1.2701 0.344944 0.126
Nitrogen Availability N deprivation 0 h NA NA 0.723869 -0.4662 0.214555
Nitrogen Availability N deprivation 3 h NA NA 1.13323 0.180442 0.948856
Nitrogen Availability N deprivation 6 h NA NA 1.20155 0.264894 0.660176
Nitrogen Availability N deprivation 12 h NA NA 1.04201 0.059367 0.908546
Nitrogen Availability N deprivation 24 h NA NA 0.85058 -0.233481 0.896868
Nitrogen Availability N deprivation 48 h NA NA 1.40926 0.494934 0.623824
Nitrogen Availability Urea log phase NA NA 2.13581 1.09478 0.0
Nitrogen Availability Cyanate log phase NA NA 2.82253 1.49699 0.0
Light Sensing High light 45 min NA NA 1.1132 0.154713 0.0
Light Sensing White light 45 min NA NA 1.4804 0.565987 0.0
Light Sensing Blue light 45 min NA NA 1.6121 0.688941 0.0
Light Sensing Red light 45 min NA NA 0.9526 -0.070057 0.0
Light Sensing Green light 45 min NA NA 0.8533 -0.228875 0.0
Light Sensing White light+DCMU 45 min NA NA 0.85328 -0.228909 0.0
Iron Availability -Fe 0 h NA NA None 0.404903 0.707658
Iron Availability -Fe 12 h NA NA None 1.122341 0.000343
Iron Availability -Fe 24 h NA NA None 0.591679 0.005575
Iron Availability -Fe 48 h NA NA None 0.798258 0.001201
Iron Availability -Fe 70 h rescue NA NA None -1.02327 4e-06

Protein Info: PMED4_15351 possible MATH domain
COG

Location: 1313124 - 1313438 (+) on scaffold: NC_005072
Protein Length: 104 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15351
Alternative Tag: PMM1365
MicrobesOnline ID: VIMSS566731
CyCOG: 3880(ID from pipeline) - 3880 (ID from previou versions)
CyCOG Size: 11

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1356_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15351
MSESNNLPQAISHKKLTYLMLNAQKDLNASDDKKNIESLEKQEFDELINNWEIVTKDVINTISKRNKNLLKNKSSNSLIALGAMEVHLNMALQALNAFKK
DSLD

>PMED4_15351
ATGAGTGAATCTAACAATTTACCTCAAGCAATAAGCCATAAAAAATTAACTTATTTGATGCTGAATGCACAAAAAGATCTTAATGCCTCTGATGATAAAA
AAAATATTGAAAGCTTAGAAAAACAAGAATTTGATGAATTAATAAATAATTGGGAGATCGTAACTAAAGATGTCATTAACACAATTTCTAAGCGAAATAA
AAACTTATTAAAAAATAAATCTTCTAATTCCTTAATTGCGTTGGGTGCTATGGAAGTTCATCTAAATATGGCATTACAAGCACTAAACGCATTCAAAAAA
GACTCTTTAGACTAA