logo
Affymetrix Probeset: MED4_ARR_1388_x_at
Probeset Position: 1345098..1345358(-)
Number of probes: 11

Microarray Data of MED4_ARR_1388_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 8079.67 9995.5 0.808331 -0.306982 0.2671
Phosphate Starvation P-depleted 4 h 3454.0 3184.5 1.08463 0.117201 0.5133
Phosphate Starvation P-depleted 12 h 2087.0 1876.0 1.11247 0.153771 0.6453
Phosphate Starvation P-depleted 24 h 1808.0 1762.0 1.02611 0.037181 0.876
Phosphate Starvation P-depleted 48 h 2194.0 1911.5 1.14779 0.198858 0.166
Nitrogen Availability N deprivation 0 h NA NA 0.549106 -0.864842 0.066946
Nitrogen Availability N deprivation 3 h NA NA 1.84419 0.882984 0.74701
Nitrogen Availability N deprivation 6 h NA NA 1.52715 0.610839 0.561088
Nitrogen Availability N deprivation 12 h NA NA 0.674621 -0.56785 0.280814
Nitrogen Availability N deprivation 24 h NA NA 1.544 0.626675 0.652595
Nitrogen Availability N deprivation 48 h NA NA 5.40092 2.43321 0.005128
Nitrogen Availability Urea log phase NA NA 1.87685 0.908316 0.0
Nitrogen Availability Cyanate log phase NA NA 2.3331 1.22225 0.0
Light Sensing High light 45 min NA NA 42.1506 5.39748 0.0
Light Sensing White light 45 min NA NA 8.0797 3.0143 0.0
Light Sensing Blue light 45 min NA NA 19.2016 4.26315 0.0
Light Sensing Red light 45 min NA NA 2.1588 1.11023 0.0
Light Sensing Green light 45 min NA NA 0.5023 -0.993379 0.0
Light Sensing White light+DCMU 45 min NA NA 0.502281 -0.993433 0.0
Iron Availability -Fe 0 h NA NA None 0.275007 0.834242
Iron Availability -Fe 12 h NA NA None 0.68437 0.011191
Iron Availability -Fe 24 h NA NA None 0.929791 7.6e-05
Iron Availability -Fe 48 h NA NA None 1.169284 2.5e-05
Iron Availability -Fe 70 h rescue NA NA None -1.318326 1e-06

Protein Info: PMED4_15941 possible high light inducible protein (hli8)
COG

Location: 1345098 - 1345358 (-) on scaffold: NC_005072
Protein Length: 86 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15941
Alternative Tag: PMM1397
MicrobesOnline ID: VIMSS566763
CyCOG: 3939(ID from pipeline) - 3939 (ID from previou versions)
CyCOG Size: 10

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1388_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15941
MSPLAVFLILIVSLTALLVASLTKQFQEENLIYSNKNQMTNSNTKTKTIEKEKVVAETLNGRFAMIGLIAAVGAYLTTGQIIPGFV

>PMED4_15941
ATGAGTCCACTAGCAGTTTTTTTGATTTTAATTGTATCTCTAACTGCTTTACTCGTTGCTTCCCTAACTAAACAATTTCAAGAAGAAAATTTAATCTACT
CAAACAAAAATCAAATGACAAACTCAAACACAAAAACTAAAACAATCGAGAAGGAAAAAGTTGTTGCAGAAACTCTCAACGGTAGATTTGCAATGATCGG
ACTTATAGCTGCAGTTGGTGCATATCTAACTACAGGTCAAATCATTCCAGGTTTCGTTTAA