logo
Affymetrix Probeset: MED4_ARR_1391_x_at
Probeset Position: 1346108..1346626(-)
Number of probes: 10

Microarray Data of MED4_ARR_1391_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Phosphate Starvation P-depleted 0 h 3477.67 5898.5 0.589585 -0.762227 0.0116
Phosphate Starvation P-depleted 4 h 1896.5 2402.5 0.789386 -0.341197 0.2585
Phosphate Starvation P-depleted 12 h 2799.0 3778.67 0.740737 -0.432967 0.1456
Phosphate Starvation P-depleted 24 h 5358.33 4159.67 1.28816 0.365314 0.12
Phosphate Starvation P-depleted 48 h 2484.5 3626.0 0.68519 -0.545423 0.117
Nitrogen Availability N deprivation 0 h NA NA 1.2605 0.334002 0.305913
Nitrogen Availability N deprivation 3 h NA NA 1.11254 0.153859 0.960196
Nitrogen Availability N deprivation 6 h NA NA 1.1544 0.207139 0.725533
Nitrogen Availability N deprivation 12 h NA NA 0.421342 -1.24694 0.00369
Nitrogen Availability N deprivation 24 h NA NA 0.58753 -0.767267 0.304104
Nitrogen Availability N deprivation 48 h NA NA 0.265124 -1.91526 0.014286
Nitrogen Availability Urea log phase NA NA 1.94302 0.9583 0.0
Nitrogen Availability Cyanate log phase NA NA 1.85666 0.892706 0.0
Light Sensing High light 45 min NA NA 0.2827 -1.82266 0.0
Light Sensing White light 45 min NA NA 0.49 -1.02915 0.0
Light Sensing Blue light 45 min NA NA 0.574 -0.800877 0.0
Light Sensing Red light 45 min NA NA 0.3412 -1.55131 0.0
Light Sensing Green light 45 min NA NA 1.5077 0.592349 0.0
Light Sensing White light+DCMU 45 min NA NA 1.50769 0.59234 0.0
Iron Availability -Fe 0 h NA NA None 0.230203 0.906398
Iron Availability -Fe 12 h NA NA None 1.423847 6.2e-05
Iron Availability -Fe 24 h NA NA None 1.397803 0.000288
Iron Availability -Fe 48 h NA NA None 1.711935 5.7e-05
Iron Availability -Fe 70 h rescue NA NA None -2.373327 0.0

Protein Info: PMED4_15971 possible Hemagglutinin-neuraminidase
COG

Location: 1346108 - 1346626 (-) on scaffold: NC_005072
Protein Length: 172 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15971
Alternative Tag: PMM1400
MicrobesOnline ID: VIMSS566766
CyCOG: 3531(ID from pipeline) - 3531 (ID from previou versions)
CyCOG Size: 31

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1391_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15971
MKLRFFPTTIFRETPKVTFFDAGLEASNGCDVVIHSEEAISPPDDFKDEQYYVHNHQSDHNLVIAGERTFVLINPAWDEPHHVIYLNRSMGALEIPIGTY
HRSISGKEGSIVLNQPTRDKFFDPAKEFIPQKLDQISLIKARKTPPVYWVWENDQIKKVGFNPIEREIKSLT

>PMED4_15971
ATGAAATTAAGATTCTTCCCAACAACAATTTTTAGAGAGACTCCAAAAGTGACATTCTTTGATGCAGGCTTGGAGGCATCTAATGGTTGCGATGTGGTAA
TTCACTCTGAAGAGGCTATATCTCCTCCAGATGATTTTAAAGATGAACAATATTACGTTCACAATCATCAAAGTGATCACAACTTAGTTATTGCTGGGGA
AAGAACATTTGTTCTAATAAATCCTGCATGGGATGAACCCCATCATGTAATTTATTTAAATAGATCTATGGGGGCATTAGAAATTCCTATTGGAACTTAT
CACAGATCAATTTCAGGAAAAGAAGGTAGTATTGTCTTAAATCAACCCACAAGAGATAAATTTTTTGATCCAGCTAAAGAATTTATCCCACAAAAATTAG
ACCAAATAAGTTTAATAAAGGCAAGAAAAACTCCACCTGTTTATTGGGTTTGGGAAAATGATCAAATTAAGAAAGTTGGGTTTAATCCGATAGAACGAGA
AATCAAATCACTAACCTGA