logo
Affymetrix Probeset: MED4_ARR_1758_x_at
Probeset Position: 830784..830950(+)
Number of probes: 4

Microarray Data of MED4_ARR_1758_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None -0.176251 0.900687
Iron Availability -Fe 12 h NA NA None 0.80488 0.000309
Iron Availability -Fe 24 h NA NA None 0.707525 0.011224
Iron Availability -Fe 48 h NA NA None 1.236952 0.000308
Iron Availability -Fe 70 h rescue NA NA None -1.442222 7e-06

Protein Info: PMED4_09841 Conserved hypothetical protein
COG

Location: 830778 - 830954 (+) on scaffold: NC_005072
Protein Length: 58 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_09841
Alternative Tag: PMM1915
MicrobesOnline ID: VIMSS1203650
CyCOG: 3329(ID from pipeline) - 3329 (ID from previou versions)
CyCOG Size: 13

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1758_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_09841
MFYCNFKSSEEKKSFYQKKKLEMLNYIKDSLERKIASVSASIEVLENQISRDKVEVSN

>PMED4_09841
ATGTTTTACTGTAACTTTAAATCCTCAGAAGAAAAAAAGTCTTTTTATCAAAAAAAGAAATTAGAAATGCTTAACTATATCAAGGATTCACTTGAAAGAA
AAATTGCATCAGTAAGTGCTTCAATAGAAGTTCTAGAAAATCAAATTTCCAGAGACAAAGTTGAAGTTAGTAATTAA