logo
Affymetrix Probeset: MED4_ARR_1811_x_at
Probeset Position: 38110..38193(+)
Number of probes: 2

Microarray Data of MED4_ARR_1811_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None -0.318326 0.870298
Iron Availability -Fe 12 h NA NA None 0.853597 0.008647
Iron Availability -Fe 24 h NA NA None -0.37707 0.265651
Iron Availability -Fe 48 h NA NA None 0.181421 0.332836
Iron Availability -Fe 70 h rescue NA NA None -0.413115 0.036167

Protein Info: PMED4_00391 Conserved hypothetical protein
COG

Location: 38074 - 38226 (+) on scaffold: NC_005072
Protein Length: 50 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_00391
Alternative Tag: PMM1800
MicrobesOnline ID: VIMSS1203562
CyCOG: 2384(ID from pipeline) - 2384 (ID from previou versions)
CyCOG Size: 2

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1811_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_00391
MDNKEKEKDISSLEFDKGKTRNDYKFLVQKLKNIKEIITLLENKFLQKEM

>PMED4_00391
ATGGATAACAAAGAGAAAGAAAAAGATATATCAAGTTTAGAATTTGATAAAGGTAAGACTCGAAATGATTATAAATTTTTAGTTCAAAAACTAAAAAATA
TAAAGGAGATTATTACTTTGTTAGAAAATAAGTTTTTGCAGAAAGAGATGTAA