logo
Affymetrix Probeset: MED4_ARR_1843_x_at
Probeset Position: 1319626..1319698(+)
Number of probes: 2

Microarray Data of MED4_ARR_1843_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None -0.237864 0.895446
Iron Availability -Fe 12 h NA NA None -0.771027 0.002124
Iron Availability -Fe 24 h NA NA None -0.603841 0.002555
Iron Availability -Fe 48 h NA NA None -0.773491 0.001327
Iron Availability -Fe 70 h rescue NA NA None 1.259423 5.8e-05

Protein Info: PMED4_15442
COG

Location: 1319606 - 1319722 (+) on scaffold: NC_005072
Protein Length: 38 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15442

MicrobesOnline ID: VIMSS5163171
CyCOG: 7516(ID from pipeline) - 7516 (ID from previou versions)
CyCOG Size: 6

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1843_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
PMED4_15442 NA Annotated previously

>PMED4_15442
MKVLKKKTLGIFEVYLIFLSCLYAGFIGYKSLLNILIT

>PMED4_15442
ATGAAAGTTCTAAAGAAAAAGACACTTGGAATCTTTGAAGTATATTTAATTTTCTTATCATGCCTATATGCCGGATTTATAGGTTATAAGTCCTTATTAA
ATATATTAATTACTTAA