logo
Affymetrix Probeset: MED4_ARR_1857_x_at
Probeset Position: 1346735..1346811(-)
Number of probes: 2

Microarray Data of MED4_ARR_1857_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None 0.507921 0.743568
Iron Availability -Fe 12 h NA NA None 1.370722 5.3e-05
Iron Availability -Fe 24 h NA NA None 1.473008 0.000253
Iron Availability -Fe 48 h NA NA None 1.826193 3.5e-05
Iron Availability -Fe 70 h rescue NA NA None -2.064917 0.0

Protein Info: PMED4_15981 Conserved hypothetical protein
COG

Location: 1346701 - 1346847 (-) on scaffold: NC_005072
Protein Length: 48 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15981
Alternative Tag: PMM2005
MicrobesOnline ID: VIMSS1203737
CyCOG: 3943(ID from pipeline) - 3943 (ID from previou versions)
CyCOG Size: 5

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1857_x_at
Diel FDR ( cutoff=0.1 ): 0.000858
Is Expressed: True

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15981
MKLQTQFTVPKKEFRDLDYVNKVKVLEETLKKECMDYPTKEDCLVCCN

>PMED4_15981
ATGAAACTACAAACTCAATTCACCGTTCCAAAAAAAGAGTTTAGAGATCTTGACTATGTCAACAAAGTAAAAGTTTTAGAAGAAACTTTAAAGAAAGAAT
GTATGGATTATCCAACAAAAGAAGATTGTTTAGTTTGTTGCAACTGA