logo
Affymetrix Probeset: MED4_ARR_1860_x_at
Probeset Position: 1084783..1084905(-)
Number of probes: 3

Microarray Data of MED4_ARR_1860_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None -0.132894 0.900304
Iron Availability -Fe 12 h NA NA None -0.988504 0.002617
Iron Availability -Fe 24 h NA NA None -0.386468 0.127296
Iron Availability -Fe 48 h NA NA None -0.766112 0.006032
Iron Availability -Fe 70 h rescue NA NA None 1.637842 1.7e-05

Protein Info: PMED4_12871 Conserved hypothetical protein
COG

Location: 1084749 - 1084931 (-) on scaffold: NC_005072
Protein Length: 60 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_12871
Alternative Tag: PMM1961
MicrobesOnline ID: VIMSS1203694
CyCOG: 3632(ID from pipeline) - 3632 (ID from previou versions)
CyCOG Size: 6

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1860_x_at

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_12871
MNYREDLEFQLQKVTLAIQEVLEDVYITDKVRQERIRKLLNFKEAIIYKGRELRIDLEAA

>PMED4_12871
ATGAACTATAGAGAAGATTTAGAGTTTCAACTTCAGAAAGTTACTTTAGCAATACAAGAGGTTCTTGAGGATGTTTACATTACAGATAAGGTAAGGCAGG
AACGAATAAGAAAACTACTTAATTTCAAAGAGGCAATAATCTATAAGGGAAGGGAACTTCGCATTGATTTAGAAGCGGCATAA