logo
Affymetrix Probeset: MED4_ARR_1936_x_at
Probeset Position: 1321052..1321178(+)
Number of probes: 3

Microarray Data of MED4_ARR_1936_x_at

Project Exp Time mean(T) mean(C) ratio(T/C) log2(T/C) q
Iron Availability -Fe 0 h NA NA None 0.364012 0.741114
Iron Availability -Fe 12 h NA NA None 0.737254 0.003908
Iron Availability -Fe 24 h NA NA None 0.582074 0.015931
Iron Availability -Fe 48 h NA NA None 1.07519 0.00052
Iron Availability -Fe 70 h rescue NA NA None -0.84944 2.3e-05

Protein Info: PMED4_15491 Conserved hypothetical protein
COG

Location: 1321009 - 1321188 (+) on scaffold: NC_005072
Protein Length: 59 aa

Genome: MED4
NCBI ID: None
Locus Tag: PMED4_15491
Alternative Tag: PMM1983
MicrobesOnline ID: VIMSS1203716
CyCOG: 3894(ID from pipeline) - 3894 (ID from previou versions)
CyCOG Size: 7

Submit BLAST to NCBI
nr (BLASTp)
nt (BLASTn)
Affymetrix Probeset: MED4_ARR_1936_x_at
Diel FDR ( cutoff=0.1 ):
Is Expressed:

GO Annotations from ARGOT2 (total Score, internal_confidence, information_content)
GO ID GO Aspect GO Term Total Score Internal Confidence Information Content
None None None None None None

GO Annotations from CAMERA
Protein GO ID Pfam ID Description E-value
None None None None None

Pfam Annotations
Protein Pfam ID Name Description E-value
None None None None None

Enzyme Information
Protein EC Number Note
None None None

>PMED4_15491
MTEIYSATSSISPFSAILWCFYPIAILILVELFLGGGFDDDNDDQDGGMMIPAYSGAKN

>PMED4_15491
ATGACAGAAATCTATTCAGCAACTTCATCAATAAGTCCATTCTCAGCAATCTTATGGTGTTTTTACCCTATAGCTATATTAATTTTGGTTGAGTTGTTTC
TAGGTGGAGGATTTGACGATGATAATGATGATCAAGATGGTGGAATGATGATCCCTGCATATTCAGGAGCTAAGAATTAA